5FJY: Mouse kinesin light chain 2

Crystal structure of mouse kinesin light chain 2 (residues 161-480). Determined by X-ray diffraction at 4.0 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 4.0 Å
Organism: MUS MUSCULUS
Chains: 6
Atoms: 6,405
Mol. weight: 110.44 kDa
Released: 24 Feb 2016

Explore 5FJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FJY contains 40 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	197-211	15
α-helix	217-231	15
α-helix	237-252	16
α-helix	256-273	18
α-helix	279-294	16
α-helix	301-316	16
α-helix	321-336	16
α-helix	340-357	18
α-helix	363-378	16
α-helix	382-397	16
α-helix	411-418	8
α-helix	446-461	16
α-helix	465-477	13

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	197-211	15
α-helix	217-231	15
α-helix	237-252	16
α-helix	256-273	18
α-helix	279-294	16
α-helix	301-316	16
α-helix	321-330	10
α-helix	341-357	17
α-helix	363-378	16
α-helix	382-397	16
α-helix	411-418	8
α-helix	446-455	10
α-helix	458-461	4
α-helix	465-470	6

Chain C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	197-211	15
α-helix	217-231	15
α-helix	237-252	16
α-helix	256-273	18
α-helix	279-294	16
α-helix	301-316	16
α-helix	321-335	15
α-helix	340-357	18
α-helix	363-379	17
α-helix	382-397	16
α-helix	411-418	8
α-helix	446-461	16
α-helix	465-477	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin light chain 2	A, B, C	protein	324	MUS MUSCULUS	O88448 (AlphaFold model)
Unknown peptide	D, E, F	protein	5	MUS MUSCULUS

Sequence of entity 1 (A, B, C), FASTA

>5FJY_1 KINESIN LIGHT CHAIN 2 (chains A, B, C)
GSHMKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPALRLTLHNLVIQYASQGRYEV
AVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGK
DHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQN
QGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRA
HEKEFGSVNGENKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLG
ALYRRQGKLEAAHTLEDCASRSRK

Sequence of entity 2 (D, E, F), FASTA

>5FJY_2 UNKNOWN PEPTIDE (chains D, E, F)
XXXXX

Primary citation

The Light Chains of Kinesin-1 are Autoinhibited. Yip, Y.Y., Pernigo, S., Sanger, A. et al. Proc Natl Acad Sci U S A (2016) 113:2418. DOI 10.1073/PNAS.1520817113 · PubMed

Other PDB entries of the same protein (UniProt O88448 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZFW 2.9 Å, Crystal structure of the TPR domain of kinesin light chain 2 in complex with a…
6EJN 3.2 Å, The KLC2 TPR domain bound to the JIP3 leucine zipper domain

Browse structure collections

About this viewer

MolViewer shows 5FJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.