6EJN: The KLC2 TPR domain

The KLC2 TPR domain bound to the JIP3 leucine zipper domain. Determined by X-ray diffraction at 3.2 Å resolution. Released 5 Sept 2018.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,207
Mol. weight: 82.72 kDa
Released: 5 Sept 2018

Explore 6EJN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EJN contains 29 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	193-195	3
α-helix	198-210	13
α-helix	214-231	18
α-helix	237-253	17
α-helix	256-273	18
α-helix	279-294	16
α-helix	298-316	19
α-helix	321-337	17
α-helix	340-357	18
α-helix	363-379	17
α-helix	382-401	20
α-helix	411-418	8
α-helix	446-462	17
α-helix	465-476	12

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	199-210	12
α-helix	214-231	18
α-helix	237-253	17
α-helix	256-273	18
α-helix	279-295	17
α-helix	298-316	19
α-helix	321-337	17
α-helix	340-357	18
α-helix	363-379	17
α-helix	382-401	20
α-helix	411-418	8
α-helix	446-462	17
α-helix	465-476	12

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	417-474	58

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	418-474	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin light chain 2	A, B	protein	291	Mus musculus	O88448 (AlphaFold model)
C-Jun-amino-terminal kinase-interacting protein 3	C, D	protein	75	Mus musculus	Q9ESN9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6EJN_1 Kinesin light chain 2 (chains A, B)
GRGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILAL
VYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRA
LEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKT
KNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKDKRRDS
APYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRSR

Sequence of entity 2 (C, D), FASTA

>6EJN_2 C-Jun-amino-terminal kinase-interacting protein 3 (chains C, D)
GPGGRMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKV
KLENRIKELEEELKR

Primary citation

Insights into Kinesin-1 Activation from the Crystal Structure of KLC2 Bound to JIP3. Cockburn, J.J.B., Hesketh, S.J., Mulhair, P. et al. Structure (2018) 26:1486-1498.e6. DOI 10.1016/j.str.2018.07.011 · PubMed

Other PDB entries of the same protein (UniProt O88448 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZFW 2.9 Å, Crystal structure of the TPR domain of kinesin light chain 2 in complex with a…
5FJY 4.0 Å, Crystal structure of mouse kinesin light chain 2 (residues 161-480)

Browse structure collections

About this viewer

MolViewer shows 6EJN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.