5FPI: Mu2 adaptin subunit of the AP2 adaptor

Name: PDB 5FPI: Mu2 adaptin subunit of the AP2 adaptor (C-terminal domain) complexed with Integrin alpha4 internalisation peptide QYKSILQE
Published: 2016-01-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

Mu2 adaptin subunit of the AP2 adaptor (C-terminal domain) complexed with Integrin alpha4 internalisation peptide QYKSILQE. Determined by X-ray diffraction at 2.77 Å resolution. Released 20 Jan 2016.

Method: X-ray diffraction
Resolution: 2.77 Å
Organisms: RATTUS NORVEGICUS, HOMO SAPIENS
Chains: 2
Atoms: 2,175
Mol. weight: 52.05 kDa
Released: 20 Jan 2016

Explore 5FPI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FPI contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	218	1	3
β-strand	241	1	3
β-strand	245-248	4	1
β-strand	253	1	2
β-strand	264-265	2	2
α-helix	267-268	2
β-strand	270-279	10	1
β-strand	287-296	10	4
β-strand	300-309	10	4
β-strand	316-325	10	1
β-strand	330-337	8	4
β-strand	341-345	5	1
β-strand	350-359	10	1
β-strand	362-372	11	4
α-helix	373-374	2
α-helix	380-381	2
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ap-2 complex subunit mu	A	protein	446	RATTUS NORVEGICUS	P84092 (AlphaFold model)
Integrin alpha-4 subunit	B	protein	8	HOMO SAPIENS	P13612 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FPI_1 AP-2 COMPLEX SUBUNIT MU (chains A)
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSMEQK
LISEEDLGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRV
IPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASEN
AIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEP
KLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (B), FASTA

>5FPI_2 INTEGRIN ALPHA-4 SUBUNIT (chains B)
QYKSILQE

Primary citation

Selective Integrin Endocytosis is Driven by Alpha Chain:Ap2 Interactions. De Franceschi, N., Arjonen, A., Elkhatib, N. et al. Nat Struct Mol Biol (2016) 23:172. DOI 10.1038/NSMB.3161 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…

Browse structure collections

About this viewer

MolViewer shows 5FPI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.