5FV8: CJun-FosW coiled coil complex

Structure of cJun-FosW coiled coil complex. Determined by X-ray diffraction at 1.99 Å resolution. Released 7 Jun 2017.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,291
Mol. weight: 18.3 kDa
Ligands: JEF
Released: 7 Jun 2017

Explore 5FV8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FV8 contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-33	31

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-29	28

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-34	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fosw	A, B	protein	38	HOMO SAPIENS
Cjun	D, E	protein	38	HOMO SAPIENS	P05412 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FV8_1 FOSW (chains A, B)
AASLDELQAEIEQLEERNYALRKEIEDLQKQLEKLGAP

Sequence of entity 2 (D, E), FASTA

>5FV8_2 CJUN (chains D, E)
AASIARLEEKVKTLKAQNYELASTANMLREQVAQLGAP

Ligands and cofactors

ID	Name	Formula	Copies
JEF	O-(O-(2-aminopropyl)-O'-(2-methoxyethyl)polypropylene glycol 500)	C30 H63 N O10	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Helix-Constrained Fos-Based Peptides Inhibit Oncogenic Activator Protein-1 and Cancer Cell Proliferation. Baxter, D., Perry, S.R., Hill, T.A. et al. To be published.

Other PDB entries of the same protein (UniProt P05412 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y3V 1.5 Å, 14-3-3 Sigma in complex with phosphorylated c-Jun peptide
5T01 1.89 Å, Human c-Jun DNA binding domain homodimer in complex with methylated DNA
1JNM 2.2 Å, Crystal Structure of the Jun/CRE Complex
8SOS 2.33 Å, Human CD1d presenting sphingomyelin C24:1 in complex with VHH nanobody 1D17
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
1T2K 3.0 Å, Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
1FOS 3.05 Å, Two human C-fos:c-jun:dna complexes
1S9K 3.1 Å, Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site
1JUN NMR study of C-jun homodimer

Browse structure collections

About this viewer

MolViewer shows 5FV8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.