5FWY: Glutamate receptor 2

Crystal structure of the AMPA receptor GluA2/A3 N-terminal domain heterodimer. Determined by X-ray diffraction at 2.12 Å resolution. Released 16 Mar 2016.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: RATTUS NORVEGICUS
Chains: 4
Atoms: 12,549
Mol. weight: 180.72 kDa
Ligands: NAG
Released: 16 Mar 2016

Explore 5FWY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FWY contains 60 α-helices and 80 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	1
α-helix	17-29	13
β-strand	32	1	2
β-strand	35	1	2
β-strand	36-44	9	1
α-helix	49-62	14
β-strand	67-69	3	1
α-helix	76-86	11
β-strand	90-92	3	1
α-helix	95-97	3
β-strand	104-106	3	1
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	3
α-helix	138-150	13
β-strand	153-158	6	3
α-helix	164-166	3
α-helix	167-180	14
β-strand	185-189	5	3
α-helix	192-204	13
β-strand	209	1	4
β-strand	213-216	4	3
β-strand	220	1	3
α-helix	221-223	3
α-helix	227-229	3
β-strand	233	1	4
β-strand	235-240	6	3
α-helix	247-256	10
α-helix	274-295	22
α-helix	320-329	10
β-strand	331-334	4	5
β-strand	337-340	4	5
β-strand	341	1	6
β-strand	347	1	6
β-strand	351-358	8	3
β-strand	361-369	9	3
β-strand	374-376	3	3

Chain B: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	7
α-helix	17-31	15
β-strand	42-49	8	7
α-helix	55-68	14
β-strand	73-75	3	7
α-helix	82-92	11
β-strand	96-98	3	7
α-helix	101-103	3
β-strand	110-112	3	7
α-helix	115-116	2
α-helix	118-127	10
β-strand	132-137	6	8
α-helix	144-156	13
β-strand	159-164	6	8
α-helix	171-183	13
β-strand	188-192	5	8
α-helix	195-207	13
β-strand	216-219	4	8
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	8
α-helix	250-259	10
α-helix	274-276	3
α-helix	277-298	22
α-helix	323-331	9
β-strand	335-337	3	9
β-strand	340-342	3	9
β-strand	343-344	2	10
β-strand	350-351	2	10
β-strand	355-360	6	8
β-strand	365-372	8	8
β-strand	376-379	4	8

Chain C: 15 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	11
α-helix	17-29	13
β-strand	32	1	12
β-strand	35	1	12
β-strand	36-44	9	11
α-helix	49-62	14
β-strand	67-69	3	11
α-helix	76-86	11
β-strand	90-92	3	11
α-helix	95-97	3
β-strand	104-106	3	11
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	13
α-helix	133-135	3
α-helix	138-150	13
β-strand	153-158	6	13
α-helix	167-180	14
β-strand	185-189	5	13
α-helix	192-204	13
β-strand	209	1	14
β-strand	213-216	4	13
β-strand	220	1	13
α-helix	221-223	3
α-helix	227-229	3
β-strand	233	1	14
β-strand	235-240	6	13
α-helix	247-256	10
α-helix	274-295	22
α-helix	320-329	10
β-strand	331-334	4	15
β-strand	337-340	4	15
β-strand	341	1	16
β-strand	346	1	11
β-strand	347	1	16
β-strand	351-358	8	13
β-strand	361-369	9	13
β-strand	373-376	4	13

Chain D: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	17
α-helix	17-31	15
β-strand	42-49	8	17
α-helix	55-68	14
β-strand	73-75	3	17
α-helix	82-92	11
β-strand	96-98	3	17
α-helix	101-103	3
β-strand	110-112	3	17
α-helix	115-116	2
α-helix	118-127	10
β-strand	132-137	6	18
α-helix	144-156	13
β-strand	159-164	6	18
α-helix	171-183	13
β-strand	188-192	5	18
α-helix	195-207	13
β-strand	216-219	4	18
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	18
α-helix	250-259	10
α-helix	274-276	3
α-helix	277-299	23
α-helix	323-331	9
β-strand	335-337	3	19
β-strand	340-342	3	19
β-strand	343-344	2	20
β-strand	349	1	17
β-strand	350-351	2	20
β-strand	355-361	7	18
β-strand	364-372	9	18
β-strand	376-379	4	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 2	A, C	protein	385	RATTUS NORVEGICUS	P19491 (AlphaFold model)
Glutamate receptor 3	B, D	protein	390	RATTUS NORVEGICUS	P19492 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5FWY_1 GLUTAMATE RECEPTOR 2 (chains A, C)
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRG
VYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQ
WDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKE
RRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRR
GNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPR
KIGYWSEVDKMVVTLTRTKHHHHHH

Sequence of entity 2 (B, D), FASTA

>5FWY_2 GLUTAMATE RECEPTOR 3 (chains B, D)
GFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTN
AFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGA
ILSLLSYYKWEKFVYLYDTERGFSVLQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEE
MDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANIT
GFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQR
VDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEM
KVSGSRKAGYWNEYERFVPFSGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	10

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors. Herguedas, B., Garcia-Nafria, J., Cais, O. et al. Science (2016) 352:3873. DOI 10.1126/SCIENCE.AAD3873 · PubMed

Other PDB entries of the same protein (UniProt P19491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YK4 1.0 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5NG9 1.15 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
6YK5 1.15 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
6YK3 1.2 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5JEI 1.23 Å, Crystal structure of the GluA2 LBD in complex with FW
4IGT 1.24 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist…
4YU0 1.26 Å, Crystal structure of a tetramer of GluA2 TR mutant ligand binding domains bound with…
5NIH 1.3 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
1MQI 1.35 Å, Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with…
5FTI 1.35 Å, Crystal structure of the GluA2 K738M-T744K LBD in complex with glutamate (lithium form)
4U21 1.39 Å, GluA2flip sLBD complexed with FW and (R,R)-2b crystal form E
4FAT 1.4 Å, Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an…

Browse structure collections

About this viewer

MolViewer shows 5FWY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.