Water-Bridge Mediates Recognition of mRNA Cap in eIF4E. Determined by X-ray diffraction at 1.97 Å resolution. Released 19 Oct 2016.
Explore 5GW6 in 3D Show helices and sheets RCSB PDB PDBe
5GW6 contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 1 |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69-78 | 10 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 1 |
| β-strand | 111-117 | 7 | 1 |
| α-helix | 119-124 | 6 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 161-167 | 7 | 1 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 1 |
| α-helix | 200-205 | 6 | |
| β-strand | 215-216 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A | protein | 196 | Homo sapiens | P06730 (AlphaFold model) |
>5GW6_1 Eukaryotic translation initiation factor 4E (chains A) MESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQL SSNLMPGCDYSLFKDGIEPMWEDAANARGGRWLITLNKQQRRSDLDRFWLETLLCLIGES FDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHA DTATKSGSTTKNRFVV
Water-Bridge Mediates Recognition of mRNA Cap in eIF4E. Lama, D., Pradhan, M.R., Brown, C.J. et al. Structure (2017) 25:188-194. DOI 10.1016/j.str.2016.11.006 · PubMed
Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.