5GW6: Eukaryotic translation initiation factor 4E

Name: PDB 5GW6: Water-Bridge Mediates Recognition of mRNA Cap in eIF4E
Published: 2016-10-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Water-Bridge Mediates Recognition of mRNA Cap in eIF4E. Determined by X-ray diffraction at 1.97 Å resolution. Released 19 Oct 2016.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,616
Mol. weight: 22.98 kDa
Released: 19 Oct 2016

Explore 5GW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GW6 contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	38-49	12	1
β-strand	60-68	9	1
α-helix	69-78	10
α-helix	82-84	3
α-helix	86	1
β-strand	89-95	7	1
β-strand	111-117	7	1
α-helix	119-124	6
α-helix	126-138	13
α-helix	143-148	6
β-strand	149-155	7	1
β-strand	161-167	7	1
α-helix	173-187	15
β-strand	196-199	4	1
α-helix	200-205	6
β-strand	215-216	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E	A	protein	196	Homo sapiens	P06730 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GW6_1 Eukaryotic translation initiation factor 4E (chains A)
MESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQL
SSNLMPGCDYSLFKDGIEPMWEDAANARGGRWLITLNKQQRRSDLDRFWLETLLCLIGES
FDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHA
DTATKSGSTTKNRFVV

Primary citation

Water-Bridge Mediates Recognition of mRNA Cap in eIF4E. Lama, D., Pradhan, M.R., Brown, C.J. et al. Structure (2017) 25:188-194. DOI 10.1016/j.str.2016.11.006 · PubMed

Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TPW 1.5 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5T46 1.53 Å, Crystal structure of the human eIF4E-eIF4G complex
8QM8 1.58 Å, Potential drug binding sites for translation initiation factor eIF4E
4TQB 1.59 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZJY 1.59 Å, Stapled-peptides tailored against initiation of translation
7D6Y 1.67 Å, eIF4E in Complex with a Disulphide-Free Autonomous VH Domain
5ZJZ 1.67 Å, Stapled-peptides tailored against initiation of translation
5EI3 1.71 Å, Co-crystal structure of eIF4E with nucleotide mimetic inhibitor.
4UED 1.75 Å, Complex of human eIF4E with the 4E binding protein 4E-BP1
5ZK9 1.76 Å, Stapled-peptides tailored against initiation of translation
4TQC 1.8 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZML 1.8 Å, Stapled-peptides tailored against initiation of translation

Browse structure collections

About this viewer

MolViewer shows 5GW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.