Crystal structure of mRojoA mutant - P63H - W143S. Determined by X-ray diffraction at 2.24 Å resolution. Released 27 Jan 2016.
Explore 5H87 in 3D Show helices and sheets RCSB PDB PDBe
5H87 contains 25 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-50 | 10 | 1 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 59-62 | 4 | |
| β-strand | 74 | 1 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 104-114 | 11 | 1 |
| β-strand | 117-127 | 11 | 1 |
| β-strand | 140-143 | 4 | 1 |
| β-strand | 146-153 | 8 | 1 |
| β-strand | 156-167 | 12 | 1 |
| β-strand | 172-183 | 12 | 1 |
| α-helix | 188-190 | 3 | |
| β-strand | 193-204 | 12 | 1 |
| β-strand | 210-221 | 12 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-50 | 10 | 1 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 104-114 | 11 | 1 |
| β-strand | 117-127 | 11 | 1 |
| α-helix | 134-137 | 4 | |
| β-strand | 140-143 | 4 | 1 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 1 |
| β-strand | 156-167 | 12 | 1 |
| β-strand | 172-183 | 12 | 1 |
| β-strand | 193-204 | 12 | 1 |
| β-strand | 210-220 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 2 |
| β-strand | 25-36 | 12 | 2 |
| β-strand | 41-50 | 10 | 2 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 59-62 | 4 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 2 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 2 |
| β-strand | 104-114 | 11 | 2 |
| β-strand | 117-127 | 11 | 2 |
| β-strand | 140-143 | 4 | 2 |
| β-strand | 146-153 | 8 | 2 |
| β-strand | 156-167 | 12 | 2 |
| β-strand | 172-183 | 12 | 2 |
| α-helix | 188-191 | 4 | |
| β-strand | 193-204 | 12 | 2 |
| β-strand | 210-220 | 11 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 3 |
| β-strand | 25-36 | 12 | 3 |
| β-strand | 41-50 | 10 | 3 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 59-62 | 4 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 3 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 3 |
| β-strand | 104-114 | 11 | 3 |
| β-strand | 117-127 | 11 | 3 |
| β-strand | 140-143 | 4 | 3 |
| β-strand | 147-152 | 6 | 3 |
| β-strand | 157-167 | 11 | 3 |
| β-strand | 172-183 | 12 | 3 |
| α-helix | 188-190 | 3 | |
| β-strand | 193-204 | 12 | 3 |
| β-strand | 210-220 | 11 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| mRojoA fluorescent protein | A, B, C, D | protein | 242 | Discosoma sp. | D1MPT3 (AlphaFold model) |
>5H87_1 mRojoA fluorescent protein (chains A, B, C, D) MGHHHHHHGVSKGEEDNMAIIKEFMRFKTHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLK VTKGGPLPFAWDILSHQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQ DSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGSEASSERMYPEDGALKGEIKLRLKLKD GGHYDAEVKTTYKAKKPVQLPGAYNANYKLDITSHNEDYTIVEQYERCEGRHSTGGMDEL YK
Brighter Red Fluorescent Proteins by Rational Design of Triple-Decker Motif. Pandelieva, A.T., Baran, M.J., Calderini, G.F. et al. ACS Chem Biol (2016) 11:508-517. DOI 10.1021/acschembio.5b00774 · PubMed
Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5H87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.