5H87: MRojoA mutant - P63H - W143S

Name: PDB 5H87: Crystal structure of mRojoA mutant - P63H - W143S
Published: 2016-01-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of mRojoA mutant - P63H - W143S. Determined by X-ray diffraction at 2.24 Å resolution. Released 27 Jan 2016.

Method: X-ray diffraction
Resolution: 2.24 Å
Organism: Discosoma sp.
Chains: 4
Atoms: 7,145
Mol. weight: 110.59 kDa
Released: 27 Jan 2016

Explore 5H87 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H87 contains 25 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	59-62	4
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
α-helix	188-190	3
β-strand	193-204	12	1
β-strand	210-221	12	1

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
α-helix	70-72	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
α-helix	134-137	4
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
β-strand	193-204	12	1
β-strand	210-220	11	1

Chain C: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	2
β-strand	25-36	12	2
β-strand	41-50	10	2
α-helix	52	1
α-helix	54	1
α-helix	59-62	4
α-helix	70-72	3
β-strand	74	1	2
α-helix	82-85	4
β-strand	91-99	9	2
β-strand	104-114	11	2
β-strand	117-127	11	2
β-strand	140-143	4	2
β-strand	146-153	8	2
β-strand	156-167	12	2
β-strand	172-183	12	2
α-helix	188-191	4
β-strand	193-204	12	2
β-strand	210-220	11	2

Chain D: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	3
β-strand	25-36	12	3
β-strand	41-50	10	3
α-helix	52	1
α-helix	54	1
α-helix	59-62	4
α-helix	70-72	3
β-strand	74	1	3
α-helix	82-85	4
β-strand	91-99	9	3
β-strand	104-114	11	3
β-strand	117-127	11	3
β-strand	140-143	4	3
β-strand	147-152	6	3
β-strand	157-167	11	3
β-strand	172-183	12	3
α-helix	188-190	3
β-strand	193-204	12	3
β-strand	210-220	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRojoA fluorescent protein	A, B, C, D	protein	242	Discosoma sp.	D1MPT3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5H87_1 mRojoA fluorescent protein (chains A, B, C, D)
MGHHHHHHGVSKGEEDNMAIIKEFMRFKTHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLK
VTKGGPLPFAWDILSHQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQ
DSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGSEASSERMYPEDGALKGEIKLRLKLKD
GGHYDAEVKTTYKAKKPVQLPGAYNANYKLDITSHNEDYTIVEQYERCEGRHSTGGMDEL
YK

Primary citation

Brighter Red Fluorescent Proteins by Rational Design of Triple-Decker Motif. Pandelieva, A.T., Baran, M.J., Calderini, G.F. et al. ACS Chem Biol (2016) 11:508-517. DOI 10.1021/acschembio.5b00774 · PubMed

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NED 0.95 Å, mRouge
6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
9FEL 1.5 Å, LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
5H89 1.76 Å, Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V

Browse structure collections

About this viewer

MolViewer shows 5H87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.