5H89: MRojoA mutant - T16V - P63Y - W143G - L163V

Name: PDB 5H89: Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V
Published: 2016-01-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V. Determined by X-ray diffraction at 1.76 Å resolution. Released 27 Jan 2016.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Discosoma sp.
Chains: 4
Atoms: 7,558
Mol. weight: 110.5 kDa
Released: 27 Jan 2016

Explore 5H89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H89 contains 16 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	59-62	4
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
β-strand	193-204	12	1
β-strand	210-220	11	1

Chain C: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	3
β-strand	25-36	12	3
β-strand	41-50	10	3
α-helix	52	1
α-helix	54	1
α-helix	59-62	4
β-strand	74	1	3
α-helix	82-85	4
β-strand	91-99	9	3
β-strand	104-114	11	3
β-strand	117-127	11	3
β-strand	140-143	4	3
β-strand	147-153	7	3
β-strand	156-167	12	3
β-strand	172-183	12	3
β-strand	193-204	12	3
β-strand	210-220	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRojoA fluorescent protein	A, B, C, D	protein	242	Discosoma sp.	D1MPT3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5H89_1 mRojoA fluorescent protein (chains A, B, C, D)
MGHHHHHHGVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLK
VTKGGPLPFAWDILSYQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQ
DSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGGEASSERMYPEDGALKGEIKVRLKLKD
GGHYDAEVKTTYKAKKPVQLPGAYNANYKLDITSHNEDYTIVEQYERCEGRHSTGGMDEL
YK

Primary citation

Brighter Red Fluorescent Proteins by Rational Design of Triple-Decker Motif. Pandelieva, A.T., Baran, M.J., Calderini, G.F. et al. ACS Chem Biol (2016) 11:508-517. DOI 10.1021/acschembio.5b00774 · PubMed

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NED 0.95 Å, mRouge
6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
9FEL 1.5 Å, LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
3LF4 1.81 Å, Crystal Structure of Fluorescent Timer Precursor Blue102

Browse structure collections

About this viewer

MolViewer shows 5H89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.