System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: NEDD4L and UbV NL.1. Determined by X-ray diffraction at 2.43 Å resolution. Released 16 Mar 2016.
Explore 5HPK in 3D Show helices and sheets RCSB PDB PDBe
5HPK contains 29 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 575-587 | 13 | |
| β-strand | 597-602 | 6 | 1 |
| α-helix | 604-606 | 3 | |
| α-helix | 607-616 | 10 | |
| α-helix | 621-625 | 5 | |
| β-strand | 627-632 | 6 | 1 |
| α-helix | 640-655 | 16 | |
| α-helix | 658-660 | 3 | |
| β-strand | 663-665 | 3 | 2 |
| β-strand | 673-675 | 3 | 2 |
| α-helix | 679-682 | 4 | |
| α-helix | 686-702 | 17 | |
| β-strand | 711 | 1 | 2 |
| α-helix | 713-719 | 7 | |
| α-helix | 722-724 | 3 | |
| α-helix | 726-729 | 4 | |
| α-helix | 734-745 | 12 | |
| α-helix | 749-751 | 3 | |
| β-strand | 754 | 1 | 3 |
| β-strand | 756-761 | 6 | 4 |
| β-strand | 764-769 | 6 | 4 |
| α-helix | 774-776 | 3 | |
| β-strand | 778 | 1 | 3 |
| α-helix | 784-796 | 13 | |
| α-helix | 801-811 | 11 | |
| α-helix | 817-820 | 4 | |
| α-helix | 825-832 | 8 | |
| α-helix | 840-844 | 5 | |
| β-strand | 847-850 | 4 | 5 |
| α-helix | 858-869 | 12 | |
| α-helix | 872-883 | 12 | |
| α-helix | 887-889 | 3 | |
| α-helix | 893-895 | 3 | |
| β-strand | 897 | 1 | 6 |
| β-strand | 902 | 1 | 6 |
| β-strand | 905-909 | 5 | 5 |
| α-helix | 916-917 | 2 | |
| β-strand | 918-920 | 3 | 5 |
| α-helix | 921-923 | 3 | |
| β-strand | 925-928 | 4 | 5 |
| α-helix | 934-947 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 7 |
| β-strand | 11-16 | 6 | 7 |
| β-strand | 22 | 1 | 8 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 7 |
| β-strand | 48-49 | 2 | 7 |
| β-strand | 55 | 1 | 8 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4-like | A | protein | 383 | Homo sapiens | Q96PU5 (AlphaFold model) |
| Ubiquitin variant NL.1 | B | protein | 86 | Homo sapiens | P62987 (AlphaFold model) |
>5HPK_1 E3 ubiquitin-protein ligase NEDD4-like (chains A) GSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEF ESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTF IGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELD LMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFT ELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDA EKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYE TFEDLREKLLMAVENAQGFEGVD
>5HPK_2 Ubiquitin variant NL.1 (chains B) MGHHHHHHMRIFVRTPTRKTITLEVEPSDTIENVKAKIQDKEGIPPDQQVLIFAGNRLED GRTLSDYNIPKESTLYLFMRLRGLEN
System-Wide Modulation of HECT E3 Ligases with Selective Ubiquitin Variant Probes. Zhang, W., Wu, K.P., Sartori, M.A. et al. Mol Cell (2016) 62:121-136. DOI 10.1016/j.molcel.2016.02.005 · PubMed
Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.