5HSF: Ig gamma-1 chain C region

1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1. Determined by X-ray diffraction at 1.52 Å resolution. Released 3 Feb 2016.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,128
Mol. weight: 30.34 kDa
Released: 3 Feb 2016

Explore 5HSF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HSF contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	318	1	1
β-strand	321-325	5	2
α-helix	326-328	3
α-helix	331-333	3
β-strand	336-346	11	2
β-strand	347	1	1
β-strand	352-357	6	3
β-strand	360-361	2	3
β-strand	365-367	3	2
α-helix	368-370	3
β-strand	371-372	2	2
β-strand	378-387	10	2
α-helix	388-392	5
β-strand	397-402	6	3
β-strand	410-415	6	3

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	318	1	4
β-strand	321-325	5	5
α-helix	326-328	3
α-helix	329-333	5
β-strand	336-346	11	5
β-strand	347	1	4
β-strand	352-356	5	6
β-strand	361	1	6
β-strand	365-367	3	5
α-helix	368-370	3
β-strand	371-372	2	5
β-strand	378-387	10	5
α-helix	388-392	5
β-strand	397-402	6	6
α-helix	407-409	3
β-strand	410-415	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-1 chain C region	A, B	protein	132	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5HSF_1 Ig gamma-1 chain C region (chains A, B)
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSEKDELGENL
YFQSAGHHHHHH

Primary citation

1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1. Minasov, G., Halavaty, A., Shuvalova, L. et al. To be published.

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
3DJ9 1.75 Å, Crystal Structure of an isolated, unglycosylated antibody CH2 domain

Browse structure collections

About this viewer

MolViewer shows 5HSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.