Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature. Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Feb 2016.
Explore 5HUR in 3D Show helices and sheets RCSB PDB PDBe
5HUR contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-12 | 3 | 1 |
| β-strand | 13-17 | 5 | 2 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 30-36 | 7 | 2 |
| β-strand | 39-40 | 2 | 3 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-67 | 13 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 3 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>5HUR_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature. Skerritt, L.A., Caro, J.A., Heroux, A. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HUR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.