5HX4: DNA dC->dU-editing enzyme APOBEC-3F

Zinc-Free APOBEC3F Catalytic Domain Crystal Structure. Determined by X-ray diffraction at 1.92 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,035
Mol. weight: 46.72 kDa
Released: 18 May 2016

Explore 5HX4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HX4 contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	192	1	1
β-strand	195	1	2
α-helix	197-204	8
α-helix	208-212	5
β-strand	217-226	10	1
β-strand	232-239	8	1
α-helix	250-257	8
α-helix	258-262	5
β-strand	267-277	11	1
α-helix	278-280	3
α-helix	281-293	13
β-strand	297-305	9	1
α-helix	312-323	12
β-strand	327-330	4	1
α-helix	333-343	11
β-strand	344	1	2
α-helix	349-351	3
α-helix	353-354	2
α-helix	357-372	16

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	192	1	3
β-strand	195	1	4
α-helix	197-204	8
β-strand	217-225	9	3
β-strand	232-239	8	3
α-helix	252-261	10
β-strand	268-275	8	3
α-helix	278-280	3
α-helix	281-293	13
β-strand	297-303	7	3
α-helix	312-323	12
β-strand	327-330	4	3
α-helix	333-343	11
β-strand	344	1	4
α-helix	349-351	3
α-helix	353-354	2
α-helix	357-372	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA dC->dU-editing enzyme APOBEC-3F	A, B	protein	199	Homo sapiens	Q8IUX4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5HX4_1 DNA dC->dU-editing enzyme APOBEC-3F (chains A, B)
GPLGSPGIPGKEILRNPMEAMDPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWK
RGVFRNQVDPETGRHAERCFLSWFADDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARH
SNVNLTIKTARLYYFDDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPW
DGLDYNFLDLDSKLQEILE

Primary citation

1.92 Angstrom Zinc-Free APOBEC3F Catalytic Domain Crystal Structure. Shaban, N.M., Shi, K., Li, M. et al. J Mol Biol (2016) 428:2307-2316. DOI 10.1016/j.jmb.2016.04.026 · PubMed

Other PDB entries of the same protein (UniProt Q8IUX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZVB 2.0 Å, APOBEC3F Chimeric Catalytic Domain in Complex with DNA(dT9)
5ZVA 2.3 Å, APOBEC3F Chimeric Catalytic Domain in Complex with DNA(dC9)
5HX5 2.33 Å, APOBEC3F Catalytic Domain Crystal Structure
3WUS 2.54 Å, Crystal Structure of the Vif-Binding Domain of Human APOBEC3F
8VUD 2.6 Å, Crystal structure of APOBEC3F-CD1
4IOU 2.75 Å, Crystal structure of the HIV-1 Vif binding, catalytically active domain of APOBEC3F
4J4J 3.1 Å, Crystal structure of the APOBEC3F Vif binding domain
5W2M 3.7 Å, APOBEC3F Catalytic Domain Complex with a Single-Stranded DNA
6NIL 3.9 Å, cryoEM structure of the truncated HIV-1 Vif/CBFbeta/A3F complex

Browse structure collections

About this viewer

MolViewer shows 5HX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.