human recombinant coagulation FXI in complex with a peptide derived from human high molecular weight kininogen (HKP). Determined by X-ray diffraction at 2.85 Å resolution. Released 6 Apr 2016.
Explore 5I25 in 3D Show helices and sheets RCSB PDB PDBe
5I25 contains 25 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 16-21 | 6 | 1 |
| α-helix | 25-34 | 10 | |
| β-strand | 40-44 | 5 | 1 |
| α-helix | 52-54 | 3 | |
| β-strand | 57-61 | 5 | 1 |
| β-strand | 70-72 | 3 | 2 |
| β-strand | 76-80 | 5 | 1 |
| β-strand | 96-102 | 7 | 3 |
| β-strand | 105-111 | 7 | 3 |
| α-helix | 115-124 | 10 | |
| β-strand | 130-134 | 5 | 3 |
| α-helix | 141-143 | 3 | |
| β-strand | 146-151 | 6 | 3 |
| β-strand | 160-170 | 11 | 3 |
| α-helix | 173-175 | 3 | |
| α-helix | 180-182 | 3 | |
| β-strand | 187 | 1 | 4 |
| β-strand | 190-192 | 3 | 5 |
| β-strand | 195-201 | 7 | 4 |
| α-helix | 205-214 | 10 | |
| β-strand | 220-224 | 5 | 4 |
| α-helix | 231-233 | 3 | |
| β-strand | 236-241 | 6 | 4 |
| β-strand | 250-252 | 3 | 5 |
| β-strand | 256-260 | 5 | 4 |
| α-helix | 263-268 | 6 | |
| β-strand | 278-284 | 7 | 6 |
| β-strand | 286-293 | 8 | 6 |
| α-helix | 296-305 | 10 | |
| β-strand | 311-315 | 5 | 6 |
| α-helix | 316 | 1 | |
| α-helix | 318-320 | 3 | |
| β-strand | 326-332 | 7 | 6 |
| β-strand | 340-351 | 12 | 6 |
| α-helix | 353-358 | 6 | |
| α-helix | 361-363 | 3 | |
| β-strand | 384-389 | 6 | 7 |
| β-strand | 395-402 | 8 | 7 |
| β-strand | 407-410 | 4 | 7 |
| α-helix | 413-415 | 3 | |
| α-helix | 421-423 | 3 | |
| β-strand | 424-428 | 5 | 7 |
| β-strand | 432 | 1 | 8 |
| β-strand | 443-450 | 8 | 7 |
| β-strand | 464-468 | 5 | 7 |
| α-helix | 471-474 | 4 | |
| β-strand | 475 | 1 | 9 |
| β-strand | 478 | 1 | 9 |
| β-strand | 482 | 1 | 10 |
| α-helix | 483-485 | 3 | |
| α-helix | 486-488 | 3 | |
| β-strand | 496-500 | 5 | 10 |
| β-strand | 513 | 1 | 8 |
| α-helix | 514 | 1 | |
| β-strand | 515-518 | 4 | 10 |
| β-strand | 521-522 | 2 | 10 |
| α-helix | 524-530 | 7 | |
| β-strand | 540-543 | 4 | 10 |
| β-strand | 560-565 | 6 | 10 |
| β-strand | 568-575 | 8 | 10 |
| α-helix | 587 | 1 | |
| β-strand | 588-592 | 5 | 10 |
| α-helix | 593-596 | 4 | |
| α-helix | 597-604 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XI | A | protein | 607 | Homo sapiens | P03951 (AlphaFold model) |
| Asn-pro-ile-ser-asp-phe-pro-asp | B | protein | 8 | Homo sapiens | P01042 (AlphaFold model) |
>5I25_1 Coagulation factor XI (chains A) ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVL KDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQE RCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNL ACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLK TSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQ KLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDN ECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVES PKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRP ICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKM ICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWI LEKTQAV
>5I25_2 ASN-PRO-ILE-SER-ASP-PHE-PRO-ASP (chains B) NPISDFPD
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
A novel DFP tripeptide motif interacts with the coagulation factor XI apple 2 domain. Wong, S.S., stergaard, S., Hall, G. et al. Blood (2016) 127:2915-2923. DOI 10.1182/blood-2015-10-676122 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.