X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site. Determined by X-ray diffraction at 3.14 Å resolution. Released 13 Apr 2016.
Explore 5I6X in 3D Show helices and sheets RCSB PDB PDBe
5I6X contains 52 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 79-80 | 2 | |
| α-helix | 85-96 | 12 | |
| α-helix | 99-111 | 13 | |
| α-helix | 114-117 | 4 | |
| α-helix | 118-123 | 6 | |
| α-helix | 124-129 | 6 | |
| α-helix | 130-143 | 14 | |
| α-helix | 149-152 | 4 | |
| α-helix | 156-159 | 4 | |
| α-helix | 160-173 | 14 | |
| α-helix | 176-188 | 13 | |
| β-strand | 209 | 1 | 1 |
| β-strand | 225 | 1 | 1 |
| α-helix | 227-231 | 5 | |
| α-helix | 232-236 | 5 | |
| α-helix | 239-241 | 3 | |
| β-strand | 251 | 1 | 2 |
| α-helix | 253-270 | 18 | |
| α-helix | 274-284 | 11 | |
| α-helix | 287-300 | 14 | |
| α-helix | 306-313 | 8 | |
| α-helix | 317-321 | 5 | |
| α-helix | 323-337 | 15 | |
| α-helix | 343-349 | 7 | |
| α-helix | 358-389 | 32 | |
| α-helix | 396-398 | 3 | |
| α-helix | 403-404 | 2 | |
| α-helix | 405-409 | 5 | |
| α-helix | 410-415 | 6 | |
| α-helix | 420-453 | 34 | |
| β-strand | 455 | 1 | 3 |
| β-strand | 458 | 1 | 3 |
| α-helix | 462-477 | 16 | |
| β-strand | 482 | 1 | 2 |
| α-helix | 485-491 | 7 | |
| α-helix | 492-496 | 5 | |
| α-helix | 497-510 | 14 | |
| α-helix | 511-515 | 5 | |
| α-helix | 518-528 | 11 | |
| α-helix | 532-534 | 3 | |
| α-helix | 535-539 | 5 | |
| α-helix | 540-544 | 5 | |
| α-helix | 545-558 | 14 | |
| α-helix | 560-562 | 3 | |
| β-strand | 564 | 1 | 4 |
| β-strand | 569 | 1 | 4 |
| α-helix | 570-571 | 2 | |
| α-helix | 574-583 | 10 | |
| α-helix | 588-599 | 12 | |
| α-helix | 604-612 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-25 | 4 | 5 |
| β-strand | 29-31 | 3 | 6 |
| β-strand | 37-39 | 3 | 5 |
| β-strand | 41-44 | 4 | 5 |
| α-helix | 48-50 | 3 | |
| β-strand | 52-58 | 7 | 7 |
| β-strand | 64-70 | 7 | 7 |
| β-strand | 78-79 | 2 | 7 |
| β-strand | 84 | 1 | 5 |
| β-strand | 87-92 | 6 | 5 |
| β-strand | 97-102 | 6 | 5 |
| β-strand | 112-118 | 7 | 7 |
| β-strand | 127 | 1 | 7 |
| β-strand | 129 | 1 | 5 |
| β-strand | 132-133 | 2 | 7 |
| β-strand | 134-136 | 3 | 6 |
| β-strand | 145-149 | 5 | 8 |
| β-strand | 160-170 | 11 | 8 |
| β-strand | 176-179 | 4 | 9 |
| β-strand | 188-196 | 9 | 8 |
| β-strand | 199-209 | 11 | 8 |
| α-helix | 210-212 | 3 | |
| β-strand | 219-224 | 6 | 9 |
| β-strand | 229-234 | 6 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25 | 1 | 10 |
| β-strand | 30-34 | 5 | 11 |
| β-strand | 39-44 | 6 | 10 |
| β-strand | 53-58 | 6 | 11 |
| β-strand | 65-69 | 5 | 11 |
| β-strand | 73-74 | 2 | 11 |
| α-helix | 75 | 1 | |
| β-strand | 82-85 | 4 | 10 |
| β-strand | 90-95 | 6 | 10 |
| α-helix | 100-102 | 3 | |
| β-strand | 105-110 | 6 | 11 |
| α-helix | 116 | 1 | |
| β-strand | 118 | 1 | 11 |
| β-strand | 122-127 | 6 | 11 |
| β-strand | 131 | 1 | 12 |
| β-strand | 134-138 | 5 | 13 |
| α-helix | 139-141 | 3 | |
| α-helix | 142-147 | 6 | |
| β-strand | 149-159 | 11 | 13 |
| β-strand | 160 | 1 | 12 |
| β-strand | 165-169 | 5 | 14 |
| β-strand | 174-175 | 2 | 14 |
| β-strand | 179-183 | 5 | 13 |
| α-helix | 184-187 | 4 | |
| β-strand | 193-202 | 10 | 13 |
| α-helix | 203-206 | 4 | |
| β-strand | 212-217 | 6 | 14 |
| α-helix | 224 | 1 | |
| β-strand | 225-229 | 5 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sodium-dependent serotonin transporter | A | protein | 549 | Homo sapiens | P31645 (AlphaFold model) |
| 8B6 antibody, heavy chain | B | protein | 221 | Mus musculus | |
| 8B6 antibody, light chain | C | protein | 214 | Mus musculus |
>5I6X_1 Sodium-dependent serotonin transporter (chains A) GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLF YMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTD QLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISW QLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSF VSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLIT LGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLE EYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSIT PETPTLVPR
>5I6X_2 8B6 antibody, heavy chain (chains B) EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSY NQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSA KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
>5I6X_3 8B6 antibody, light chain (chains C) DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPD RFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
| ID | Name | Formula | Copies |
|---|---|---|---|
| CLR | Cholesterol | C27 H46 O | 1 |
| 8PR | Paroxetine | C19 H20 F N O3 | 1 |
| LMT | Dodecyl-beta-D-maltoside | C24 H46 O11 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (NA, CL) are not listed.
X-ray structures and mechanism of the human serotonin transporter. Coleman, J.A., Green, E.M., Gouaux, E. Nature (2016) 532:334-339. DOI 10.1038/nature17629 · PubMed
Other PDB entries of the same protein (UniProt P31645 (AlphaFold model), which also has an AlphaFold model), best resolution first:
5I6X is part of these collections:
MolViewer shows 5I6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.