Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone G02857790. Determined by X-ray diffraction at 1.07 Å resolution. Released 20 Apr 2016.
Explore 5I89 in 3D Show helices and sheets RCSB PDB PDBe
5I89 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1084-1086 | 3 | |
| α-helix | 1087-1102 | 16 | |
| α-helix | 1109-1111 | 3 | |
| α-helix | 1117-1120 | 4 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1143 | 9 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1196 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CREB-binding protein | A | protein | 118 | Homo sapiens | Q92793 (AlphaFold model) |
>5I89_1 CREB-binding protein (chains A) GSKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIK RKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 69B | (4R)-6-(3-cyclopropyl-1-methyl-1H-indazol-5-yl)-4-methyl-1,3,4,5-tetrahydro-2H-… | C21 H22 N4 O | 1 |
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (ACT) are not listed.
Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637). Taylor, A.M., Cote, A., Hewitt, M.C. et al. ACS Med Chem Lett (2016) 7:531-536. DOI 10.1021/acsmedchemlett.6b00075 · PubMed
Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.