5IA8: Ubiquitin like protein with an E1 fragment

Structure of a Ubiquitin like protein with an E1 fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Mar 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,445
Mol. weight: 21.15 kDa
Released: 8 Mar 2017

Explore 5IA8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IA8 contains 9 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	-12--10	3
α-helix	-1-2	4
β-strand	3-10	8	1
β-strand	18-24	7	1
β-strand	28	1	2
α-helix	29-39	11
α-helix	44-46	3
β-strand	48-51	4	1
β-strand	56	1	1
β-strand	62	1	2
α-helix	63-70	8
β-strand	73-77	5	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	-2-0	3	1
α-helix	1	1
β-strand	3-10	8	3
β-strand	18-24	7	3
β-strand	28	1	4
α-helix	29-40	12
α-helix	44-46	3
β-strand	48-51	4	3
β-strand	56	1	3
β-strand	62	1	4
α-helix	63-70	8
β-strand	73-77	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme 5,Ubiquitin-fold modifier 1	A, B	protein	97	Homo sapiens	P61960 (AlphaFold model), Q9GZZ9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5IA8_1 Ubiquitin-like modifier-activating enzyme 5,Ubiquitin-fold modifier 1 (chains A, B)
SIIHEDNEWGIELVMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAAT
SAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG

Primary citation

Novel insights into the interaction of UBA5 with UFM1 via a UFM1-interacting sequence. Padala, P., Oweis, W., Mashahreh, B. et al. Sci Rep (2017) 7:508-508. DOI 10.1038/s41598-017-00610-0 · PubMed

Other PDB entries of the same protein (UniProt P61960 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W3N 1.6 Å, Crystal structure of Ufm1 fused to UFBP1 UFIM
8BZR 1.78 Å, UFC1-UFM1 conjugate
5IAA 1.85 Å, Crystal structure of human UBA5 in complex with UFM1
5IA7 2.0 Å, Crystal structure of Ubiquitin fold modifier 1 (Ufm1)
5L95 2.1 Å, Crystal structure of human UBA5 in complex with UFM1 and AMP
6H77 2.1 Å, E1 enzyme for ubiquitin like protein activation in complex with UBL
5HKH 2.55 Å, Crystal structure of Ufm1 in complex with UBA5
8OJ5 2.9 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 3 (in-vitro reconstitution)
9GY4 3.0 Å, 60S ribosomal subunit in complex with E3-UFM1 ligase and RQC machinery components NEMF…
8OHD 3.1 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 3 (native)
8QFC 3.2 Å, UFL1 E3 ligase bound 60S ribosome
8OJ0 3.3 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 2 (native)

Browse structure collections

About this viewer

MolViewer shows 5IA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.