5IG3: Human CaMKII-alpha hub

Crystal structure of the human CaMKII-alpha hub. Determined by X-ray diffraction at 2.75 Å resolution. Released 23 Mar 2016.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,312
Mol. weight: 105.12 kDa
Released: 23 Mar 2016

Explore 5IG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IG3 contains 29 α-helices and 38 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	330-332	3	1
α-helix	336-339	4
α-helix	344-362	19
α-helix	366-371	6
β-strand	373-380	8	1
α-helix	382-384	3
β-strand	389-390	2	1
α-helix	393-397	5
α-helix	398-403	6
α-helix	404-405	2
β-strand	411-421	11	1
β-strand	426-438	13	1
β-strand	444-458	15	1
β-strand	461-470	10	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	345-363	19
α-helix	366-371	6
β-strand	373-380	8	2
α-helix	382-384	3
β-strand	388-390	3	2
α-helix	393-397	5
α-helix	398-402	5
β-strand	411-421	11	2
β-strand	426-438	13	2
β-strand	444-458	15	2
β-strand	461-471	11	2

Chain C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	332-333	2	3
α-helix	344-362	19
α-helix	366-371	6
β-strand	373-380	8	3
α-helix	382-384	3
β-strand	388-390	3	3
α-helix	393-400	8
β-strand	411-421	11	3
β-strand	426-438	13	3
β-strand	444-457	14	3
β-strand	462-470	9	3

Chain D: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	347-362	16
α-helix	366-371	6
β-strand	373-380	8	4
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	4
α-helix	393-401	9
β-strand	411-421	11	4
β-strand	426-438	13	4
β-strand	444-457	14	4
β-strand	462-471	10	4

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	347-362	16
α-helix	366-371	6
β-strand	373-380	8	5
α-helix	382-384	3
β-strand	389-390	2	5
α-helix	393-399	7
β-strand	411-421	11	5
β-strand	426-438	13	5
β-strand	444-457	14	5
β-strand	462-470	9	5

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	347-362	16
α-helix	366-372	7
β-strand	373-380	8	6
α-helix	382-384	3
β-strand	389-390	2	6
α-helix	393-396	4
β-strand	411-421	11	6
β-strand	426-439	14	6
β-strand	443-457	15	6
β-strand	462-471	10	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit alpha	A, B, C, D, E, F	protein	153	Homo sapiens	Q9UQM7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5IG3_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A, B, C, D, E, F)
GSSHHHHHHSSGLEVLFQGPHMVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEP
EALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGG
IPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSV

Primary citation

Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II. Bhattacharyya, M., Stratton, M.M., Going, C.C. et al. Elife (2016) 5. DOI 10.7554/eLife.13405 · PubMed

Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X5G 1.85 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory…
7UJR 1.95 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
6OF8 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJT 2.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in…
9EOY 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
6X5Q 2.14 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1
7REC 2.2 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJQ 2.25 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
2VZ6 2.3 Å, Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in…
7KL0 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
7KL1 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
6VZK 2.55 Å, Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain

Browse structure collections

About this viewer

MolViewer shows 5IG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.