5II0: Human calcitonin receptor ectodomain

Crystal structure of the human calcitonin receptor ectodomain in complex with a truncated salmon calcitonin analogue. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 May 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Oncorhynchus gorbuscha
Chains: 6
Atoms: 3,088
Mol. weight: 51.76 kDa
Ligands: URE
Released: 11 May 2016

Explore 5II0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5II0 contains 16 α-helices and 32 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	41-61	21
α-helix	63	1
α-helix	65	1
β-strand	71-72	2	1
β-strand	75-76	2	2
β-strand	81-82	2	2
β-strand	85-86	2	1
β-strand	90-94	5	3
α-helix	95-96	2
β-strand	107-111	5	3
β-strand	112	1	4
β-strand	118	1	4
β-strand	120-121	2	5
β-strand	126-127	2	5
β-strand	130	1	3
α-helix	132-134	3

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
α-helix	42-61	20
α-helix	63	1
α-helix	65	1
β-strand	71-72	2	6
β-strand	75-76	2	7
β-strand	81-82	2	7
β-strand	85-86	2	6
β-strand	89-94	6	8
α-helix	95-96	2
β-strand	107-112	6	8
β-strand	118	1	8
β-strand	120	1	9
β-strand	127	1	9
β-strand	130	1	8

Chain C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	45-61	17
α-helix	63-65	3
β-strand	71-72	2	10
β-strand	75-76	2	11
β-strand	81-82	2	11
β-strand	85-86	2	10
β-strand	90-94	5	12
α-helix	95-96	2
β-strand	107-111	5	12
β-strand	112	1	13
β-strand	118	1	13
β-strand	120-121	2	14
β-strand	126-127	2	14
β-strand	130	1	12
α-helix	132-135	4

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	23-26	4

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	22-26	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcitonin receptor	A, B, C	protein	122	Homo sapiens	P30988 (AlphaFold model)
Calcitonin	D, E, F	protein	25	Oncorhynchus gorbuscha	Q91970 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5II0_1 Calcitonin receptor (chains A, B, C)
GSAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCW
DDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKL
KN

Sequence of entity 2 (D, E, F), FASTA

>5II0_2 Calcitonin (chains D, E, F)
VLGKLSQELHKLQTYPRTNTGSGTP

Ligands and cofactors

ID	Name	Formula	Copies
URE	Urea	C H4 N2 O	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Type II Turn of Receptor-bound Salmon Calcitonin Revealed by X-ray Crystallography. Johansson, E., Hansen, J.L., Hansen, A.M. et al. J Biol Chem (2016) 291:13689-13698. DOI 10.1074/jbc.M116.726034 · PubMed

Other PDB entries of the same protein (UniProt P30988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PFO 1.78 Å, Crystal structure of N-glycosylated human calcitonin receptor extracellular domain in…
8F0K 1.9 Å, Human Amylin3 Receptor in complex with Gs and Pramlintide analogue peptide San385
8F0J 2.0 Å, Calcitonin Receptor in complex with Gs and Pramlintide analogue peptide San45
8F2B 2.0 Å, Amylin 3 Receptor in complex with Gs and Pramlintide analogue peptide San45
7TYF 2.2 Å, Human Amylin1 Receptor in complex with Gs and rat amylin peptide
8F2A 2.2 Å, Human Amylin3 Receptor in complex with Gs and Pramlintide analogue peptide San385…
9BP3 2.2 Å, Human Amylin1 Receptor in complex with Gs and cagrilintide
9BUB 2.3 Å, Human calcitonin Receptor in complex with Gs and cagrilintide in the bypass conformation
7TZF 2.4 Å, Human Amylin3 Receptor in complex with Gs and rat amylin peptide
9AUC 2.4 Å, Human Amylin1 Receptor in Complex with Gs and human Calcitonin Gene-Related Peptide
9BUD 2.5 Å, Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation
7TYX 2.55 Å, Human Amylin2 Receptor in complex with Gs and rat amylin peptide

Browse structure collections

About this viewer

MolViewer shows 5II0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.