5IQP: 14-3-3 protein tau isoform

14-3-3 protein tau isoform. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Mar 2016.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,804
Mol. weight: 55.78 kDa
Released: 23 Mar 2016

Explore 5IQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IQP contains 27 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-36	3
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	112-132	21
α-helix	136-159	24
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	203-205	3
α-helix	211-229	19

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-36	2
α-helix	38-68	31
α-helix	74-100	27
α-helix	101-105	5
α-helix	112-130	19
α-helix	136-159	24
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-200	16
α-helix	203-205	3
α-helix	208-210	3
α-helix	211-229	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein theta	A, B	protein	245	Homo sapiens	P27348 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5IQP_1 14-3-3 protein theta (chains A, B)
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN

Primary citation

Structure of a 14-3-3 protein and implications for coordination of multiple signalling pathways. Xiao, B., Smerdon, S.J., Jones, D.H. et al. Nature (1995) 376:188-191. DOI 10.1038/376188a0 · PubMed

Other PDB entries of the same protein (UniProt P27348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCR 1.99 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T340
6KZG 2.0 Å, 14-3-3 protein in Complex with CIC S301 phosphorylated peptide
6BCY 2.3 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T360
6BD1 2.35 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at S366
6KZH 2.65 Å, 14-3-3 protein in Complex with CIC S173 phosphorylated peptide
2BTP 2.8 Å, 14-3-3 Protein Theta (Human) Complexed to Peptide
6BQT 2.8 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and T360
6BD2 2.9 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and S366

Browse structure collections

About this viewer

MolViewer shows 5IQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.