6KZH: 14-3-3 protein

14-3-3 protein in Complex with CIC S173 phosphorylated peptide. Determined by X-ray diffraction at 2.65 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,723
Mol. weight: 61.63 kDa
Released: 30 Sept 2020

Explore 6KZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KZH contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	1-15	15
α-helix	19-30	12
α-helix	35-36	2
α-helix	38-66	29
α-helix	76-100	25
α-helix	101-105	5
α-helix	112-130	19
α-helix	136-159	24
α-helix	165-180	16
α-helix	185-200	16
α-helix	213-229	17

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	1-15	15
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	76-100	25
α-helix	101-105	5
α-helix	112-130	19
α-helix	136-159	24
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	203-205	3
α-helix	211-228	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein theta	A, B	protein	263	Homo sapiens	P27348 (AlphaFold model)
CIC pS173 peptide	C, Q	protein	8	Homo sapiens	Q96RK0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KZH_1 14-3-3 protein theta (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASENLYFQGEKTELIQKAKLAEQAERYDDMATCMKAVTE
QGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELR
SICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQE
AFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSY
KDSTLIMQLLRDNLTLWTSDSAG

Sequence of entity 2 (C, Q), FASTA

>6KZH_2 CIC pS173 peptide (chains C, Q)
RTQSLSAL

Primary citation

14-3-3 protein in Complex with CIC S173 phosphorylated peptide. Wen, Y., Shao, Y. To be published.

Other PDB entries of the same protein (UniProt P27348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCR 1.99 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T340
6KZG 2.0 Å, 14-3-3 protein in Complex with CIC S301 phosphorylated peptide
6BCY 2.3 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T360
6BD1 2.35 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at S366
5IQP 2.6 Å, 14-3-3 protein tau isoform
2BTP 2.8 Å, 14-3-3 Protein Theta (Human) Complexed to Peptide
6BQT 2.8 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and T360
6BD2 2.9 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and S366

Browse structure collections

About this viewer

MolViewer shows 6KZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.