5IXI: Human JAK1 FERM/SH2

Name: PDB 5IXI: Structure of human JAK1 FERM/SH2 in complex with IFNLR1/IL10RA chimera
Published: 2016-05-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Structure of human JAK1 FERM/SH2 in complex with IFNLR1/IL10RA chimera. Determined by X-ray diffraction at 2.57 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.57 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,828
Mol. weight: 69.5 kDa
Released: 18 May 2016

Explore 5IXI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IXI contains 24 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	37-39	3	1
α-helix	46-47	2
β-strand	48-49	2	1
β-strand	54-56	3	2
α-helix	57-67	11
α-helix	75-77	3
β-strand	78-82	5	1
β-strand	87-88	2	1
α-helix	89-90	2
β-strand	94-96	3	2
β-strand	104-109	6	1
β-strand	127-128	2	3
α-helix	152-168	17
α-helix	172	1
β-strand	173	1	4
α-helix	174-176	3
α-helix	179-203	25
α-helix	218-220	3
α-helix	223-229	7
α-helix	234-250	17
α-helix	251-255	5
α-helix	256-258	3
α-helix	263-277	15
β-strand	278	1	4
β-strand	284-288	5	5
β-strand	290-294	5	6
β-strand	299-303	5	6
β-strand	313-318	6	5
β-strand	322-327	6	5
α-helix	362-363	2
β-strand	364-367	4	5
α-helix	369-371	3
β-strand	372-378	7	6
β-strand	381-386	6	6
β-strand	391-395	5	6
α-helix	399-416	18
α-helix	425-427	3
α-helix	430-437	8
β-strand	441	1	7
α-helix	446-455	10
β-strand	465-467	3	7
β-strand	474-477	4	7
β-strand	498-503	6	7
β-strand	506-509	4	7
β-strand	515-516	2	7
α-helix	519-526	8
β-strand	531-533	3	8
β-strand	536-538	3	8
β-strand	556-557	2	3

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	259-261	3
α-helix	263-264	2
α-helix	268-270	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK1	A	protein	544	Homo sapiens	P23458 (AlphaFold model)
Chimera protein of Interferon lambda receptor 1 and Interleukin-10 receptor subunit alpha	B	protein	53	Homo sapiens	Q13651 (AlphaFold model), Q8IU57 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IXI_1 Tyrosine-protein kinase JAK1 (chains A)
MHHHHHHGENLYFQGSGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLF
ALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGY
EKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAIS
HYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICD
SSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVT
GNLGIQWRHKPNVVSVEKEKNKLKRKKLENKDKKDEEKNKIREEWNNFSFFPEITHIVIK
ESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQN
GCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNF
QIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVAT
KGNS

Sequence of entity 2 (B), FASTA

>5IXI_2 Chimera protein of Interferon lambda receptor 1 and Interleukin-10 receptor subunit alpha (chains B)
GSKTLMGNPWFQRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLK

Primary citation

The Structural Basis for Class II Cytokine Receptor Recognition by JAK1. Ferrao, R., Wallweber, H.J., Ho, H. et al. Structure (2016) 24:897-905. DOI 10.1016/j.str.2016.03.023 · PubMed

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
10PI 1.54 Å, JAK1 kinase (JH1 domain) in complex with povorcitinib
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6GGH 1.7 Å, Human jak1 kinase domain in complex with inhibitor
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4L00 1.8 Å, Crystal structure of the apo Jak1 pseudokinase domain
6ELR 1.8 Å, Human jak1 kinase domain in complex with compound 7

Browse structure collections

About this viewer

MolViewer shows 5IXI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.