5IZU: PDB entry 5IZU

A new binding site outside the canonical PDZ domain determines the specific interaction between Shank and SAPAP and their function. Determined by X-ray diffraction at 2.49 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,232
Mol. weight: 34.57 kDa
Released: 18 May 2016

Explore 5IZU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IZU contains 8 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	544-552	9	1
β-strand	555-560	6	1
α-helix	562-564	3
β-strand	565-574	10	2
β-strand	583-588	6	2
β-strand	597	1	3
β-strand	607-612	6	2
α-helix	617-620	4
α-helix	627	1
β-strand	628-632	5	2
β-strand	635-636	2	2
α-helix	642-651	10
β-strand	655-664	10	2

Chains B and D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	964-971	8	3
β-strand	972-976	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 and multiple ankyrin repeat domains protein 3	A, C	protein	139	Mus musculus	Q4ACU6 (AlphaFold model)
peptide from Disks large-associated protein 3	B, D	protein	15	Mus musculus	Q6PFD5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5IZU_1 SH3 and multiple ankyrin repeat domains protein 3 (chains A, C)
GPGSEFDTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLR
GAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVV
GLIRQGGNRLVMKVVSVTR

Sequence of entity 2 (B, D), FASTA

>5IZU_2 peptide from Disks large-associated protein 3 (chains B, D)
ADSIEIYIPEAQTRL

Primary citation

A binding site outside the canonical PDZ domain determines the specific interaction between Shank and SAPAP and their function. Zeng, M., Shang, Y., Guo, T. et al. Proc Natl Acad Sci U S A (2016) 113:E3081-E3090. DOI 10.1073/pnas.1523265113 · PubMed

Other PDB entries of the same protein (UniProt Q4ACU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O5N 1.83 Å, Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a…
32CR 1.98 Å, SHANK3 PDZ (570-664) in complex with an internal PDZ binding motif (843-864) in Densin-180
9KSQ 2.79 Å, Crystal Structure of the mouse Shank3 SAM domain
6KYK 2.82 Å, Crystal structure of Shank3 NTD-ANK mutant in complex with Rap1
6KYH 3.3 Å, Crystal structure of Shank3 NTD-ANK A42K mutant in complex with HRas

Browse structure collections

About this viewer

MolViewer shows 5IZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.