32CR: SHANK3 PDZ

SHANK3 PDZ (570-664) in complex with an internal PDZ binding motif (843-864) in Densin-180. Determined by X-ray diffraction at 1.98 Å resolution. Released 22 Jul 2026.

Method: X-ray diffraction
Resolution: 1.98 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 8
Atoms: 3,955
Mol. weight: 54.75 kDa
Released: 22 Jul 2026

Explore 32CR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

32CR contains 14 α-helices and 34 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	-1-5	7	1
β-strand	14-19	6	1
β-strand	38-43	6	1
α-helix	48-51	4
α-helix	58	1
β-strand	59-63	5	1
β-strand	66-67	2	1
α-helix	73-82	10
β-strand	86-92	7	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	11-13	3
β-strand	16-21	6	1
α-helix	25-27	3

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	-1-5	7	2
β-strand	14-19	6	2
β-strand	31	1	3
β-strand	34	1	3
β-strand	38-43	6	2
α-helix	48-52	5
α-helix	58	1
β-strand	59-63	5	2
β-strand	66-67	2	2
α-helix	73-82	10
β-strand	86-92	7	2

Chains D and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	16-21	6	2

Chain E: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	0-5	6	4
β-strand	14-19	6	4
β-strand	31	1	5
β-strand	34	1	5
β-strand	38-43	6	4
α-helix	48-51	4
α-helix	58	1
β-strand	59-63	5	4
β-strand	66-67	2	4
α-helix	73-82	10
β-strand	86-92	7	4

Chain G: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	-1-5	7	6
β-strand	10	1	7
β-strand	14-19	6	6
β-strand	38-43	6	6
α-helix	48-51	4
α-helix	58	1
β-strand	59-63	5	6
β-strand	66-67	2	6
α-helix	73-82	10
β-strand	86-92	7	6

Chain H: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	16-21	6	6
β-strand	24	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 and multiple ankyrin repeat domains protein 3	A, C, E, G	protein	101	Mus musculus	Q4ACU6 (AlphaFold model)
Leucine-rich repeat-containing protein 7	B, D, F, H	protein	23	Rattus norvegicus	P70587 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>32CR_1 SH3 and multiple ankyrin repeat domains protein 3 (chains A, C, E, G)
GIDPFTVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGL
RTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT

Sequence of entity 2 (B, D, F, H), FASTA

>32CR_2 Leucine-rich repeat-containing protein 7 (chains B, D, F, H)
QNWTRTPSPFEDRTAFPSKLETC

Primary citation

An internal PDZ-binding motif in Densin-180 promotes activity-dependent SHANK scaffold remodelling. Otani, Y., Srinivasan, V., Toller, J. et al. bioRxiv (2026). DOI 10.64898/2026.07.07.736929

Other PDB entries of the same protein (UniProt Q4ACU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O5N 1.83 Å, Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a…
5IZU 2.49 Å, A new binding site outside the canonical PDZ domain determines the specific interaction…
9KSQ 2.79 Å, Crystal Structure of the mouse Shank3 SAM domain
6KYK 2.82 Å, Crystal structure of Shank3 NTD-ANK mutant in complex with Rap1
6KYH 3.3 Å, Crystal structure of Shank3 NTD-ANK A42K mutant in complex with HRas

Browse structure collections

About this viewer

MolViewer shows 32CR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.