9KSQ: Mouse Shank3 SAM domain

Crystal Structure of the mouse Shank3 SAM domain. Determined by X-ray diffraction at 2.79 Å resolution. Released 3 Dec 2025.

Method: X-ray diffraction
Resolution: 2.79 Å
Organism: Mus musculus
Chains: 1
Atoms: 609
Mol. weight: 9.59 kDa
Released: 3 Dec 2025

Explore 9KSQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KSQ contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1658-1661	4
α-helix	1664-1666	3
α-helix	1669-1678	10
α-helix	1682-1684	3
α-helix	1685-1690	6
α-helix	1695-1700	6
α-helix	1703-1708	6
α-helix	1714-1726	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 and multiple ankyrin repeat domains protein 3	A	protein	83	Mus musculus	Q4ACU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9KSQ_1 SH3 and multiple ankyrin repeat domains protein 3 (chains A)
GPGSEFGPRRPFQQKPLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFV
ELGVTRVGHRMNIERALRQLDGS

Primary citation

Structure of Shank3 SAM domain at 2.79 Angstroms resolution. Shen, Z., Zhang, M. To be published.

Other PDB entries of the same protein (UniProt Q4ACU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O5N 1.83 Å, Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a…
32CR 1.98 Å, SHANK3 PDZ (570-664) in complex with an internal PDZ binding motif (843-864) in Densin-180
5IZU 2.49 Å, A new binding site outside the canonical PDZ domain determines the specific interaction…
6KYK 2.82 Å, Crystal structure of Shank3 NTD-ANK mutant in complex with Rap1
6KYH 3.3 Å, Crystal structure of Shank3 NTD-ANK A42K mutant in complex with HRas

Browse structure collections

About this viewer

MolViewer shows 9KSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.