5J5F: Acetylcholine Binding Protein
X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with N4,N4-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl)pyrimidine-2,4-diamine. Determined by X-ray diffraction at 2.04 Å resolution. Released 8 Mar 2017.
- Method
- X-ray diffraction
- Resolution
- 2.04 Å
- Organism
- Lymnaea stagnalis
- Chains
- 10
- Atoms
- 19,030
- Mol. weight
- 255.86 kDa
- Ligands
- 6GH, NAG, PO4
- Released
- 8 Mar 2017
Explore 5J5F in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5J5F contains 42 α-helices and 145 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 27-42 | 16 | 1 |
| β-strand | 47-59 | 13 | 1 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 2 |
| β-strand | 91 | 1 | 1 |
| β-strand | 96-97 | 2 | 1 |
| β-strand | 102-106 | 5 | 1 |
| β-strand | 110-113 | 4 | 1 |
| β-strand | 116-122 | 7 | 1 |
| β-strand | 134-142 | 9 | 2 |
| β-strand | 150-153 | 4 | 1 |
| α-helix | 161-163 | 3 | |
| β-strand | 171-185 | 15 | 2 |
| β-strand | 188-203 | 16 | 2 |
Chains B and I: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 27-42 | 16 | 3 |
| β-strand | 47-59 | 13 | 3 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 3 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 4 |
| β-strand | 91 | 1 | 3 |
| β-strand | 96-97 | 2 | 3 |
| β-strand | 102-106 | 5 | 3 |
| β-strand | 110-113 | 4 | 3 |
| β-strand | 116-122 | 7 | 3 |
| β-strand | 134-142 | 9 | 4 |
| β-strand | 150-154 | 5 | 3 |
| β-strand | 158-159 | 2 | 4 |
| β-strand | 171-185 | 15 | 4 |
| β-strand | 188-203 | 16 | 4 |
Chains C, E and J: 4 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 22 | 1 | 5 |
| β-strand | 25 | 1 | 5 |
| β-strand | 27-42 | 16 | 6 |
| β-strand | 47-59 | 13 | 6 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 6 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 6 |
| β-strand | 91 | 1 | 6 |
| β-strand | 96-97 | 2 | 6 |
| β-strand | 102-106 | 5 | 6 |
| β-strand | 110-113 | 4 | 6 |
| β-strand | 116-122 | 7 | 6 |
| β-strand | 134-142 | 9 | 6 |
| β-strand | 150-154 | 5 | 6 |
| β-strand | 158-159 | 2 | 6 |
| β-strand | 171-185 | 15 | 6 |
| β-strand | 188-203 | 16 | 6 |
Chain D: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 27-42 | 16 | 7 |
| β-strand | 47-59 | 13 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 7 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 8 |
| β-strand | 91 | 1 | 7 |
| β-strand | 96-97 | 2 | 7 |
| β-strand | 102-106 | 5 | 7 |
| β-strand | 110-113 | 4 | 7 |
| β-strand | 116-122 | 7 | 7 |
| β-strand | 134-142 | 9 | 8 |
| β-strand | 150-154 | 5 | 7 |
| β-strand | 159 | 1 | 8 |
| β-strand | 171-185 | 15 | 8 |
| β-strand | 188-203 | 16 | 8 |
Chain F: 4 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -5--2 | 4 | |
| α-helix | 0-13 | 14 | |
| β-strand | 27-42 | 16 | 12 |
| β-strand | 47-59 | 13 | 12 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 12 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 13 |
| β-strand | 91 | 1 | 12 |
| β-strand | 96-97 | 2 | 12 |
| β-strand | 102-106 | 5 | 12 |
| β-strand | 110-113 | 4 | 12 |
| β-strand | 116-122 | 7 | 12 |
| β-strand | 134-142 | 9 | 13 |
| β-strand | 150-154 | 5 | 12 |
| β-strand | 171-185 | 15 | 13 |
| β-strand | 188-203 | 16 | 13 |
Chain G: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 27-42 | 16 | 14 |
| β-strand | 47-59 | 13 | 14 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 14 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 15 |
| β-strand | 96-97 | 2 | 14 |
| β-strand | 102-106 | 5 | 14 |
| β-strand | 110-113 | 4 | 14 |
| β-strand | 116-122 | 7 | 14 |
| β-strand | 124 | 1 | 15 |
| β-strand | 134-142 | 9 | 15 |
| β-strand | 150-154 | 5 | 14 |
| α-helix | 161-163 | 3 | |
| β-strand | 171-185 | 15 | 15 |
| β-strand | 188-203 | 16 | 15 |
Chain H: 4 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -6--4 | 3 | |
| α-helix | 0-13 | 14 | |
| β-strand | 22 | 1 | 16 |
| β-strand | 25 | 1 | 16 |
| β-strand | 27-42 | 16 | 17 |
| β-strand | 47-59 | 13 | 17 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 17 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 18 |
| β-strand | 91 | 1 | 17 |
| β-strand | 96-97 | 2 | 17 |
| β-strand | 102-106 | 5 | 17 |
| β-strand | 110-113 | 4 | 17 |
| β-strand | 116-122 | 7 | 17 |
| β-strand | 134-142 | 9 | 18 |
| β-strand | 150-154 | 5 | 17 |
| β-strand | 159 | 1 | 18 |
| β-strand | 171-185 | 15 | 18 |
| β-strand | 188-203 | 16 | 18 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine-binding protein | A, B, C, D, E, F, G, H, I, J | protein | 218 | Lymnaea stagnalis | P58154 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>5J5F_1 Acetylcholine-binding protein (chains A, B, C, D, E, F, G, H, I, J)
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVF
WQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVL
YMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFE
ILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 6GH | N~4~,N~4~-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl)pyrimidine-2,4-diamine | C20 H18 N6 S | 10 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 10 |
| PO4 | Phosphate ion | O4 P | 11 |
Water and common crystallization additives (DMS, GOL) are not listed.
Primary citation
Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins. Kaczanowska, K., Camacho Hernandez, G.A., Bendiks, L. et al. J Am Chem Soc (2017) 139:3676-3684. DOI 10.1021/jacs.6b10746 · PubMed
Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
- 4ZK1 1.75 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in…
- 4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
- 4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
- 8P11 1.9 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
- 7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
- 7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
- 7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
- 5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
- 3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
- 4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…
- 7PE5 2.1 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
Browse structure collections
About this viewer
MolViewer shows 5J5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.