The identification and pharmacological characterization of 6-(tert-butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a highly potent and selective inhibitor of RIP2 Kinase, GSK583 complex. Determined by X-ray diffraction at 2.53 Å resolution. Released 18 May 2016.
Explore 5J7B in 3D Show helices and sheets RCSB PDB PDBe
5J7B contains 30 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 2 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-27 | 10 | 2 |
| β-strand | 30-37 | 8 | 2 |
| β-strand | 43-48 | 6 | 2 |
| α-helix | 59-72 | 14 | |
| β-strand | 78 | 1 | 3 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-86 | 6 | 2 |
| β-strand | 91-96 | 6 | 2 |
| β-strand | 102 | 1 | 3 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 3 |
| β-strand | 160-162 | 3 | 3 |
| α-helix | 195-197 | 3 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-295 | 13 | |
| α-helix | 299-309 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 4 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-27 | 10 | 4 |
| β-strand | 30-37 | 8 | 4 |
| β-strand | 43-48 | 6 | 4 |
| α-helix | 61-72 | 12 | |
| β-strand | 78 | 1 | 5 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-86 | 6 | 4 |
| β-strand | 91-96 | 6 | 4 |
| β-strand | 102 | 1 | 5 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 160-162 | 3 | 5 |
| α-helix | 195-198 | 4 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-295 | 13 | |
| α-helix | 299-309 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-interacting serine/threonine-protein kinase 2 | A, B | protein | 326 | Homo sapiens | O43353 (AlphaFold model) |
>5J7B_1 Receptor-interacting serine/threonine-protein kinase 2 (chains A, B) MDYKDDDDKENLYFQGMNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQV AVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLN ELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIAD FGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLS RKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFL KCLIELEPVLRTFEEITFLEAVIQLK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 6GD | 6-(tert-butylsulfonyl)-N-(5-fluoro-2H-indazol-3-yl)quinolin-4-amine | C20 H19 F N4 O2 S | 2 |
The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase. Haile, P.A., Votta, B.J., Marquis, R.W. et al. J Med Chem (2016) 59:4867-4880. DOI 10.1021/acs.jmedchem.6b00211 · PubMed
Other PDB entries of the same protein (UniProt O43353 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5J7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.