5JBM: Crystal structgure of Cac1 C-terminus

Name: PDB 5JBM: Crystal structgure of Cac1 C-terminus
Published: 2016-10-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structgure of Cac1 C-terminus. Determined by X-ray diffraction at 3.0 Å resolution. Released 26 Oct 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 654
Mol. weight: 16.96 kDa
Released: 26 Oct 2016

Explore 5JBM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JBM contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	527-537	11
α-helix	544-554	11
α-helix	560-570	11
β-strand	571-573	3	1
β-strand	584-586	3	1
α-helix	589-598	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromatin assembly factor 1 subunit p90	A	protein	150	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q12495 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JBM_1 Chromatin assembly factor 1 subunit p90 (chains A)
SNFENLSEENKRYLQQLKAEVIIETDGPIDPFKEPKTSSLPSKRSNSDLQAQTASQSQSP
EKKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAIRSSG
KGDLPRKWVIKDAQNWENLRANANMPTPSL

Primary citation

The Cac1 subunit of histone chaperone CAF-1 organizes CAF-1-H3/H4 architecture and tetramerizes histones. Liu, W.H., Roemer, S.C., Zhou, Y. et al. Elife (2016) 5. DOI 10.7554/eLife.18023 · PubMed

Other PDB entries of the same protein (UniProt Q12495 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8THW 2.6 Å, Cac1 PIP motif bound to PCNA
5EJO 2.75 Å, Crystal structure of the winged helix domain in Chromatin assembly factor 1 subunit p90
8DEI 2.81 Å, Structure of the Cac1 KER domain

Browse structure collections

About this viewer

MolViewer shows 5JBM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.