5JBT: Mesotrypsin

Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (APLP2). Determined by X-ray diffraction at 1.4 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,385
Mol. weight: 30.3 kDa
Ligands: CA
Released: 9 Nov 2016

Explore 5JBT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JBT contains 11 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-34	5	3
β-strand	40-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-67	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
α-helix	111-114	4
β-strand	115	1	5
β-strand	118	1	5
β-strand	122	1	2
α-helix	123-124	2
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-215	8	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-244	10

Chain X: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	6
α-helix	9-10	2
β-strand	14	1	2

Chain Y: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	6
β-strand	29-33	5	6
α-helix	40-42	3
β-strand	46	1	6
α-helix	48-54	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PRSS3 protein	A	protein	224	Homo sapiens	P35030 (AlphaFold model)
Amyloid-like protein 2	X	protein	14	Homo sapiens	Q06481 (AlphaFold model)
Amyloid-like protein 2	Y	protein	38	Homo sapiens	Q06481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JBT_1 PRSS3 protein (chains A)
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISG
WGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGP
VVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Sequence of entity 2 (X), FASTA

>5JBT_2 Amyloid-like protein 2 (chains X)
KAVCSQEAMTGPCR

Sequence of entity 3 (Y), FASTA

>5JBT_3 Amyloid-like protein 2 (chains Y)
MPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

An Acrobatic Substrate Metamorphosis Reveals a Requirement for Substrate Conformational Dynamics in Trypsin Proteolysis. Kayode, O., Wang, R., Pendlebury, D.F. et al. J Biol Chem (2016) 291:26304-26319. DOI 10.1074/jbc.M116.758417 · PubMed

Other PDB entries of the same protein (UniProt P35030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TP0 1.25 Å, Human mesotrypsin in complex with diminazene
3P95 1.3 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
2R9P 1.4 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(BPTI)
4DG4 1.4 Å, Human mesotrypsin-S39Y complexed with bovine pancreatic trypsin inhibitor (BPTI)
3P92 1.6 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
9BOT 1.6 Å, Human mesotrypsin (PRSS3) unliganded and in autoinhibited (E*) conformation
4U32 1.65 Å, Human mesotrypsin complexed with HAI-2 Kunitz domain 1
1H4W 1.7 Å, Structure of human trypsin IV (brain trypsin)
9BOS 1.7 Å, Human mesotrypsin (PRSS3) unliganded and in an active (E) conformation
5C67 1.83 Å, Human Mesotrypsin in complex with amyloid precursor protein inhibitor variant…
6BX8 1.98 Å, Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant…
6GFI 2.3 Å, Structure of Human Mesotrypsin in complex with APPI variant T11V/M17R/I18F/F34V

Browse structure collections

About this viewer

MolViewer shows 5JBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.