5C67: Human Mesotrypsin

Human Mesotrypsin in complex with amyloid precursor protein inhibitor variant APPI-M17G/I18F/F34V. Determined by X-ray diffraction at 1.83 Å resolution. Released 4 May 2016.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,289
Mol. weight: 66.78 kDa
Released: 4 May 2016

Explore 5C67 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C67 contains 21 α-helices and 43 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-37	6	3
β-strand	39-48	10	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-67	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
α-helix	111-114	4
β-strand	122	1	2
α-helix	123-124	2
α-helix	128-130	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-215	8	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-244	10

Chain B: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	6
β-strand	20-21	2	7
α-helix	22-23	2
β-strand	30-34	5	8
β-strand	40-48	9	8
β-strand	51-54	4	8
α-helix	56-58	3
β-strand	64-67	4	8
β-strand	72	1	9
β-strand	81-90	10	8
β-strand	104-108	5	8
α-helix	122-124	3
β-strand	135-140	6	7
β-strand	154	1	9
β-strand	156-162	7	7
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	7
β-strand	189	1	6
β-strand	198-201	4	7
β-strand	204-215	8	7
β-strand	226-230	5	7
α-helix	231-234	4
α-helix	235-244	10

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-9	2
β-strand	14	1	7
β-strand	18-24	7	10
β-strand	29-35	7	10
β-strand	45	1	10
α-helix	48-54	7

Chain E: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	8-9	2
β-strand	14	1	2
β-strand	18-24	7	5
β-strand	29-35	7	5
β-strand	45	1	5
α-helix	48-55	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin-3	A, B	protein	224	Homo sapiens	P35030 (AlphaFold model)
Amyloid beta A4 protein	C, E	protein	81	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5C67_1 Trypsin-3 (chains A, B)
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISG
WGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGP
VVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Sequence of entity 2 (C, E), FASTA

>5C67_2 Amyloid beta A4 protein (chains C, E)
YVDYKDDDDKEFEVCSEQAETGPCRAGFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEY
CMAVCGSAIPRHHHHHHAAAN

Primary citation

Combinatorial protein engineering of proteolytically resistant mesotrypsin inhibitors as candidates for cancer therapy. Cohen, I., Kayode, O., Hockla, A. et al. Biochem J (2016) 473:1329-1341. DOI 10.1042/BJ20151410 · PubMed

Other PDB entries of the same protein (UniProt P35030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TP0 1.25 Å, Human mesotrypsin in complex with diminazene
3P95 1.3 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
2R9P 1.4 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(BPTI)
4DG4 1.4 Å, Human mesotrypsin-S39Y complexed with bovine pancreatic trypsin inhibitor (BPTI)
5JBT 1.4 Å, Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (APLP2)
3P92 1.6 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
9BOT 1.6 Å, Human mesotrypsin (PRSS3) unliganded and in autoinhibited (E*) conformation
4U32 1.65 Å, Human mesotrypsin complexed with HAI-2 Kunitz domain 1
1H4W 1.7 Å, Structure of human trypsin IV (brain trypsin)
9BOS 1.7 Å, Human mesotrypsin (PRSS3) unliganded and in an active (E) conformation
6BX8 1.98 Å, Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant…
6GFI 2.3 Å, Structure of Human Mesotrypsin in complex with APPI variant T11V/M17R/I18F/F34V

Browse structure collections

About this viewer

MolViewer shows 5C67 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.