5JCY: Spir2-GTBM

Spir2-GTBM bound to MyoVa-GTD. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,623
Mol. weight: 48.54 kDa
Released: 28 Sept 2016

Explore 5JCY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JCY contains 26 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1475-1476	2	1
α-helix	1479-1481	3
α-helix	1482-1486	5
α-helix	1487-1491	5
α-helix	1498-1501	4
α-helix	1506-1520	15
α-helix	1524-1545	22
α-helix	1549-1568	20
α-helix	1573-1575	3
α-helix	1581-1584	4
β-strand	1591-1592	2	2
α-helix	1594-1624	31
α-helix	1625-1629	5
β-strand	1653	1	3
β-strand	1656	1	3
α-helix	1659-1675	17
α-helix	1680-1704	25
β-strand	1710	1	4
α-helix	1711-1730	20
α-helix	1739-1742	4
α-helix	1743-1753	11
α-helix	1759-1768	10
α-helix	1774-1783	10
β-strand	1785	1	4
α-helix	1792-1795	4
α-helix	1796-1805	10
α-helix	1823-1825	3
α-helix	1836-1838	3
α-helix	1843-1845	3
β-strand	1851-1852	2	1

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	405-406	2
β-strand	407-408	2	2
α-helix	409-413	5
α-helix	414-417	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A	protein	397	Homo sapiens	Q9Y4I1 (AlphaFold model)
Protein spire homolog 2	B	protein	27	Homo sapiens	Q8WWL2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JCY_1 Unconventional myosin-Va (chains A)
GAMGSVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVR
HADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFM
KHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGV
SGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGA
ITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKK
KTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLL
MDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV

Sequence of entity 2 (B), FASTA

>5JCY_2 Protein spire homolog 2 (chains B)
QRPRPRVLLKAPTLAEMEEMNTSEEEE

Primary citation

Coordinated recruitment of Spir actin nucleators and myosin V motors to Rab11 vesicle membranes. Pylypenko, O., Welz, T., Tittel, J. et al. Elife (2016) 5. DOI 10.7554/eLife.17523 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4I1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LX2 1.5 Å, Crystal structure of Myo5a globular tail domain in complex with melanophilin GTBD
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
4LX1 1.87 Å, Crystal structure of Myo5a globular tail domain
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
4J5L 2.2 Å, Structure of the Cargo Binding Domain from Human Myosin Va
4LLI 2.2 Å, Crystal Structure of human Myosin 5a globular domain

Browse structure collections

About this viewer

MolViewer shows 5JCY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.