5JMT: Zika virus NS3 helicase

Crystal structure of Zika virus NS3 helicase. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 May 2016.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Zika virus
Chains: 1
Atoms: 3,955
Mol. weight: 50.57 kDa
Released: 25 May 2016

Explore 5JMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JMT contains 25 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	176	1	1
α-helix	181-184	4
β-strand	189-192	4	1
α-helix	200-204	5
α-helix	205-214	10
β-strand	219-223	5	1
α-helix	226-235	10
β-strand	242-243	2	1
β-strand	258-262	5	1
α-helix	263-271	9
α-helix	275-277	3
β-strand	281-285	5	1
α-helix	292-306	15
β-strand	311-315	5	1
β-strand	333-337	5	2
α-helix	339-341	3
α-helix	350-353	4
β-strand	359-362	4	2
α-helix	366-378	13
β-strand	383-386	4	2
α-helix	391-394	4
α-helix	397-400	4
β-strand	405-408	4	2
β-strand	422-425	4	2
β-strand	428-435	8	3
β-strand	439-447	9	3
α-helix	448-449	2
α-helix	450-457	8
β-strand	469-473	5	2
α-helix	486-494	9
β-strand	500	1	4
β-strand	503	1	4
α-helix	505-508	4
α-helix	509-514	6
α-helix	523-525	3
α-helix	526-536	11
α-helix	543-551	9
α-helix	560-562	3
α-helix	567-569	3
α-helix	570-571	2
β-strand	572-573	2	5
β-strand	576-577	2	5
β-strand	579-581	3	6
β-strand	587-589	3	6
β-strand	596	1	3
α-helix	597-599	3
α-helix	603-613	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NS3 helicase	A	protein	450	Zika virus	A0A024B7W1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JMT_1 NS3 helicase (chains A)
GPGSEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRV
VAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIMDEA
HFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERAWSS
GFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVV
TTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKP
GDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTE
QRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAEVWTRHGEK
RVLKPRWMDARVCSDHAALKSFKEFAAGKR

Primary citation

The crystal structure of Zika virus helicase: basis for antiviral drug design. Tian, H., Ji, X., Yang, X. et al. Protein Cell (2016) 7:450-454. DOI 10.1007/s13238-016-0275-4 · PubMed

Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KQR 1.33 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine
6LD1 1.4 Å, Zika NS5 polymerase domain
6LD2 1.4 Å, Zika NS5 polymerase domain
5KQS 1.5 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine and…
6LD4 1.5 Å, Zika NS5 polymerase domain
6S0J 1.5 Å, Structure of Zika virus NS3 helicase in complex with ADP-MgF3(H2O)-
5ULP 1.55 Å, Structure of the NS5 methyltransferase from Zika bound to MS2042
5Y6N 1.57 Å, Zika virus helicase in complex with ADP
7M1V 1.6 Å, Structure of Zika virus NS2b-NS3 protease mutant binding the compound NSC86314 in the…
5KVE 1.7 Å, Zika specific antibody, ZV-48, bound to ZIKA envelope DIII
6RWZ 1.7 Å, Structure of Zika virus NS3 helicase in complex with ADP-BeF3
5MRK 1.9 Å, Structural basis of Zika virus methyltransferase inhibition by sinefungin

Browse structure collections

About this viewer

MolViewer shows 5JMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.