5KQR: NS5 methyltransferase from Zika virus

Name: PDB 5KQR: Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine
Published: 2016-09-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine. Determined by X-ray diffraction at 1.33 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Zika virus
Chains: 1
Atoms: 2,380
Mol. weight: 30.07 kDa
Ligands: PO4, SAM
Released: 14 Sept 2016

Explore 5KQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KQR contains 13 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	21-27	7
β-strand	33-36	4	1
α-helix	38-45	8
β-strand	53	1	2
α-helix	58-67	10
β-strand	75-80	6	3
α-helix	86-92	7
β-strand	97-103	7	3
α-helix	111-114	4
α-helix	121-123	3
β-strand	124-127	4	3
α-helix	132-134	3
β-strand	142-145	4	3
α-helix	154-172	19
β-strand	178-183	6	3
α-helix	189-202	14
β-strand	205-207	3	3
β-strand	219-222	4	3
α-helix	229-242	14
α-helix	248-251	4
β-strand	252-255	4	1
α-helix	256-257	2
β-strand	258	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methyltransferase	A	protein	268	Zika virus	A0A024B7W1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5KQR_1 Methyltransferase (chains A)
GSGGGTGETLGEKWKARLNQMSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRG
SAKLRWLVERGYLQPYGKVIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQS
YGWNIVRLKSGVDVFHMAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGA
FCIKVLCPYTSTMMETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQ
LLLGRMDGPRRPVKYEEDVNLGSGTRAV

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Structures of NS5 Methyltransferase from Zika Virus. Coloma, J., Jain, R., Rajashankar, K.R. et al. Cell Rep (2016) 16:3097-3102. DOI 10.1016/j.celrep.2016.08.091 · PubMed

Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6LD1 1.4 Å, Zika NS5 polymerase domain
6LD2 1.4 Å, Zika NS5 polymerase domain
5KQS 1.5 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine and…
6LD4 1.5 Å, Zika NS5 polymerase domain
6S0J 1.5 Å, Structure of Zika virus NS3 helicase in complex with ADP-MgF3(H2O)-
5ULP 1.55 Å, Structure of the NS5 methyltransferase from Zika bound to MS2042
5Y6N 1.57 Å, Zika virus helicase in complex with ADP
7M1V 1.6 Å, Structure of Zika virus NS2b-NS3 protease mutant binding the compound NSC86314 in the…
5KVE 1.7 Å, Zika specific antibody, ZV-48, bound to ZIKA envelope DIII
6RWZ 1.7 Å, Structure of Zika virus NS3 helicase in complex with ADP-BeF3
5JMT 1.8 Å, Crystal structure of Zika virus NS3 helicase
5MRK 1.9 Å, Structural basis of Zika virus methyltransferase inhibition by sinefungin

Browse structure collections

About this viewer

MolViewer shows 5KQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.