6RWZ: Zika virus NS3 helicase

Structure of Zika virus NS3 helicase in complex with ADP-BeF3. Determined by X-ray diffraction at 1.7 Å resolution. Released 15 Jul 2020.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Zika virus
Chains: 1
Atoms: 3,863
Mol. weight: 51.29 kDa
Ligands: ADP, BEF, MN
Released: 15 Jul 2020

Explore 6RWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6RWZ contains 25 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	189-192	4	1
α-helix	194-195	2
α-helix	200-204	5
α-helix	205-214	10
β-strand	219-223	5	1
α-helix	226-235	10
β-strand	241-243	3	1
α-helix	250-252	3
β-strand	258-262	5	1
α-helix	263-271	9
α-helix	275-277	3
β-strand	281-285	5	1
α-helix	292-306	15
β-strand	311-315	5	1
β-strand	334-337	4	2
α-helix	339-341	3
α-helix	350-353	4
β-strand	359-362	4	2
α-helix	366-378	13
β-strand	383-386	4	2
α-helix	391-400	10
β-strand	405-408	4	2
α-helix	410-413	4
β-strand	422-425	4	2
β-strand	428-435	8	3
β-strand	439-447	9	3
β-strand	448	1	4
α-helix	449	1
α-helix	450-457	8
β-strand	470-473	4	2
β-strand	477	1	4
β-strand	484	1	3
α-helix	485-494	10
β-strand	500	1	5
β-strand	503	1	5
α-helix	505-508	4
α-helix	509-512	4
α-helix	523-525	3
α-helix	526-537	12
α-helix	543-551	9
α-helix	560-562	3
α-helix	567-569	3
β-strand	572-573	2	6
β-strand	576-577	2	6
β-strand	579-581	3	7
β-strand	587-589	3	7
β-strand	596	1	3
α-helix	597-599	3
α-helix	603-613	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 3	A	protein	451	Zika virus	A0A024B7W1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6RWZ_1 Non-structural protein 3 (chains A)
MGSSHHHHHHMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEM
EEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDP
SSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERAWSSGFDWV
TDYSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDIS
EMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYL
YGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTF
VELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAEVWTRHGEKRVLKP
RWMDARVCSDHAALKSFKEFAAGKRGAAFGV

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
BEF	Beryllium trifluoride ion	Be F3	1
MN	Manganese (II) ion	Mn	1

Primary citation

Octahedral Trifluoromagnesate, an Anomalous Metal Fluoride Species, Stabilizes the Transition State in a Biological Motor. Ge, M., Molt Jr., R.W., Jenkins, H.T. et al. ACS Catal (2021) 11:2769-2773. DOI 10.1021/acscatal.0c04500 · PubMed

Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KQR 1.33 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine
6LD1 1.4 Å, Zika NS5 polymerase domain
6LD2 1.4 Å, Zika NS5 polymerase domain
5KQS 1.5 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine and…
6LD4 1.5 Å, Zika NS5 polymerase domain
6S0J 1.5 Å, Structure of Zika virus NS3 helicase in complex with ADP-MgF3(H2O)-
5ULP 1.55 Å, Structure of the NS5 methyltransferase from Zika bound to MS2042
5Y6N 1.57 Å, Zika virus helicase in complex with ADP
7M1V 1.6 Å, Structure of Zika virus NS2b-NS3 protease mutant binding the compound NSC86314 in the…
5KVE 1.7 Å, Zika specific antibody, ZV-48, bound to ZIKA envelope DIII
5JMT 1.8 Å, Crystal structure of Zika virus NS3 helicase
5MRK 1.9 Å, Structural basis of Zika virus methyltransferase inhibition by sinefungin

Browse structure collections

About this viewer

MolViewer shows 6RWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.