5JPX: TRIM21 B-box2

Solution structure of the TRIM21 B-box2 (B2). Determined by solution NMR. Released 9 Aug 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 356
Mol. weight: 5.21 kDa
Ligands: ZN
Released: 9 Aug 2017

Explore 5JPX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JPX contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	91-92	2	1
β-strand	97-98	2	1
β-strand	102-103	2	2
β-strand	108-109	2	2
α-helix	112-115	4
β-strand	125-126	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM21	A	protein	45	Homo sapiens	P19474 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JPX_1 E3 ubiquitin-protein ligase TRIM21 (chains A)
GTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution NMR structure of the TRIM21 B-box2 and identification of residues involved in its interaction with the RING domain. Wallenhammar, A., Anandapadamanaban, M., Lemak, A. et al. PLoS One (2017) 12:e0181551-e0181551. DOI 10.1371/journal.pone.0181551 · PubMed

Other PDB entries of the same protein (UniProt P19474 (AlphaFold model), which also has an AlphaFold model), best resolution first:

32QO 1.3 Å, Human TRIM21 PRYSPRY domain in complex with compound 28 (Z38)
9PLM 1.32 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-021)
32QL 1.4 Å, Human TRIM21 PRYSPRY domain in complex with HGC652
9QBA 1.45 Å, Human TRIM21 PRYSPRY domain in complex with AL236
9II5 1.49 Å, Crystal structure of human TRIM21 PRYSPRY in complex with compound 1
32QM 1.5 Å, Human TRIM21 PRYSPRY domain in complex with compound 5 (Z31)
8Y58 1.6 Å, Crystal structure of TRIM21 PRYSPRY (D355A) in complex with acepromazine.
9PLL 1.6 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-056)
8Y5B 1.74 Å, Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (R)-hydroxyl-acepromazine.
32QN 1.8 Å, Human TRIM21 PRYSPRY domain in complex with compound 29 (Z37)
8Y59 1.89 Å, Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (S)-hydroxyl-acepromazine.
5OLM 1.95 Å, TRIM21

Browse structure collections

About this viewer

MolViewer shows 5JPX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.