5JRT: Human Tankyrase 2 (TNKS2) SAM domain

Crystal structure of the human Tankyrase 2 (TNKS2) SAM domain (DH902/924RE). Determined by X-ray diffraction at 1.53 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 550
Mol. weight: 8.8 kDa
Released: 3 Aug 2016

Explore 5JRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JRT contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	876-884	9
α-helix	888-890	3
α-helix	891-896	6
α-helix	901-904	4
α-helix	909-914	6
α-helix	920-936	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tankyrase-2	A	protein	77	Homo sapiens	Q9H2K2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JRT_1 Tankyrase-2 (chains A)
SNAEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLRVLVEMGHKELKEIGINAYGHR
EKLIKGVERLISGQQGL

Primary citation

Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling. Mariotti, L., Templeton, C.M., Ranes, M. et al. Mol Cell (2016) 63:498-513. DOI 10.1016/j.molcel.2016.06.019 · PubMed

Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BXO 1.33 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n2m3
5BXU 1.35 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n4m5
5NWG 1.4 Å, Crystal structure of TNKS2 in complex with 7-chloro-2-{4-[(2-hydroxyethyl)(methyl)amino]p…
5NWD 1.45 Å, Crystal structure of TNKS2 in complex with 2-[4-(diethylamino)phenyl]-3,4-dihydroquinazol…
4PNL 1.5 Å, Crystal structure of TNKS-2 in complex with DR2313.
5NVE 1.5 Å, Crystal structure of TNKS2 in complex with 2-(4-ethoxyphenyl)-3,4-dihydroquinazolin-4-one
5NWC 1.5 Å, Crystal structure of TNKS2 in complex with 2-(2-aminophenyl)-3,4-dihydroquinazolin-4-one
7CE4 1.5 Å, Tankyrase2 catalytic domain in complex with K-476
3TWR 1.55 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2
5C5R 1.55 Å, Crystal structure of human tankyrase-2 in complex with a pyranopyridone inhibitor
5NVF 1.55 Å, Crystal structure of TNKS2 in complex with 2-[4-(pyridin-2-yl)phenyl]-3,4-dihydroquinazol…
4TJU 1.57 Å, Crystal Structure of human Tankyrase 2 in complex with 3,4-CPQ-5-C.

Browse structure collections

About this viewer

MolViewer shows 5JRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.