5JVR: PDB entry 5JVR
The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Aug 2016.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organisms
- Mus musculus, Drosophila melanogaster, Homo sapiens
- Chains
- 8
- Atoms
- 4,801
- Mol. weight
- 71.9 kDa
- Released
- 3 Aug 2016
Explore 5JVR in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5JVR contains 22 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-46 | 37 | |
| α-helix | 55-64 | 10 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-48 | 40 | |
| α-helix | 55-65 | 11 | |
Chain C: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-48 | 40 | |
| α-helix | 50-52 | 3 | |
| α-helix | 55-65 | 11 | |
| α-helix | 71-73 | 3 | |
Chain D: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-48 | 41 | |
| α-helix | 55-64 | 10 | |
| α-helix | 72-74 | 3 | |
Chain E: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-48 | 40 | |
| α-helix | 55-64 | 10 | |
Chain F: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-48 | 40 | |
| α-helix | 50-52 | 3 | |
| α-helix | 55-64 | 10 | |
| α-helix | 71-73 | 3 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-48 | 39 | |
| α-helix | 55-64 | 10 | |
Chain H: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-48 | 41 | |
| α-helix | 56-65 | 10 | |
| α-helix | 66-68 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Chimera protein of mouse KIF3A,fruit fly Kinesin-1 and human EB1 | A, B, C, D, E, F, G, H | protein | 75 | Mus musculus, Drosophila melanogaster, Homo sapiens | P17210 (AlphaFold model), P28741 (AlphaFold model), Q15691 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>5JVR_1 Chimera protein of mouse KIF3A,fruit fly Kinesin-1 and human EB1 (chains A, B, C, D, E, F, G, H)
LSNEDPKDALAEEWKRRYEKEKEKVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRI
VDILYATDEGFVIPD
Primary citation
Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed
Other PDB entries of the same protein (UniProt P17210 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5JVU 1.95 Å, The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1
- 2Y65 2.2 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer-tail complex
- 5JVS 2.25 Å, The neck-linker + DAL and alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1
- 7BJS 2.28 Å, Crystal structure of Khc/atypical Tm1 complex
- 2Y5W 2.7 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer
Browse structure collections
About this viewer
MolViewer shows 5JVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.