5JX1: PDB entry 5JX1

The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1. Determined by X-ray diffraction at 1.67 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.67 Å
Organisms: Mus musculus, Homo sapiens
Chains: 1
Atoms: 612
Mol. weight: 8.92 kDa
Released: 3 Aug 2016

Explore 5JX1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JX1 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-45	41
α-helix	54-64	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Kinesin-like protein KIF3A and Microtubule-associated protein RP/EB family…	A	protein	75	Mus musculus, Homo sapiens	P28741 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JX1_1 Chimera protein of Kinesin-like protein KIF3A and Microtubule-associated protein RP/EB family member 1 (chains A)
LSNEDPKDALLRQFQKEIEELKKKLEELEKERDFYFGKLRNIELICQENEGENDPVLQRI
VDILYATDEGFVIPD

Primary citation

Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed

Other PDB entries of the same protein (UniProt P28741 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JVR 2.1 Å, The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila…
9W9H 2.83 Å, Cryo-EM structure of the mouse kinesin-2 tail in complex with KAP3 adaptor
9W9I 2.9 Å, Cryo-EM structure of the kinesin-2 tail domain in complex with KAP3 and APC

Browse structure collections

About this viewer

MolViewer shows 5JX1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.