5JZE: Erve virus viral OTU domain protease

Erve virus viral OTU domain protease in complex with mouse ISG15. Determined by X-ray diffraction at 2.47 Å resolution. Released 19 Oct 2016.

Method: X-ray diffraction
Resolution: 2.47 Å
Organisms: Mus musculus, Erve virus
Chains: 4
Atoms: 4,142
Mol. weight: 54.86 kDa
Ligands: AYE, FLC
Released: 19 Oct 2016

Explore 5JZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JZE contains 31 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	10-12	3
β-strand	13-16	4	4
β-strand	19-27	9	4
α-helix	28-31	4
β-strand	32-35	4	4
α-helix	36-38	3
α-helix	43-51	9
α-helix	61-65	5
α-helix	68-75	8
α-helix	76-78	3
α-helix	80-85	6
α-helix	89-96	8
β-strand	104	1	3
α-helix	105-115	11
β-strand	119-124	6	4
β-strand	129-136	8	4
α-helix	141-143	3
β-strand	145-150	6	4
β-strand	154-160	7	4
α-helix	161	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	80-85	6	1
β-strand	91-96	6	1
β-strand	101	1	2
α-helix	102-112	11
α-helix	117-119	3
β-strand	120-124	5	1
β-strand	127-128	2	1
β-strand	134	1	2
α-helix	135-138	4
β-strand	145-150	6	1
β-strand	153	1	3

Chain C: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	10-12	3
β-strand	13-16	4	8
β-strand	19-27	9	8
α-helix	28-31	4
β-strand	32-35	4	8
α-helix	36-38	3
α-helix	43-51	9
α-helix	61-66	6
α-helix	68-75	8
α-helix	76-78	3
α-helix	80-85	6
α-helix	89-96	8
β-strand	104	1	7
α-helix	105-115	11
β-strand	119-124	6	8
β-strand	129-136	8	8
α-helix	141-143	3
β-strand	145-150	6	8
β-strand	154-160	7	8

Chain D: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	80-85	6	5
β-strand	91-96	6	5
β-strand	101	1	6
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	5
β-strand	127-128	2	5
β-strand	134	1	6
α-helix	135-138	4
β-strand	145-150	6	5
β-strand	153	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein ISG15	B, D	protein	76	Mus musculus	Q64339 (AlphaFold model)
RNA-dependent RNA polymerase	A, C	protein	159	Erve virus	J3RTH4 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>5JZE_1 Ubiquitin-like protein ISG15 (chains B, D)
PLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEY
GLKPQCTVIKHLRLRG

Sequence of entity 2 (A, C), FASTA

>5JZE_2 RNA-dependent RNA polymerase (chains A, C)
VNRLDAIVWENIEGNLSRAFLTLDLHAFFNVNKEVGDGNCFYRALSRLHSESRTSNEHLY
YRLLIPDAVDKYFDIEPEAIGLGLNKQEYVSKAILDGEWAGSLEASMLSKFLDITIIIWI
VDDSGTIISANRYGEGRPSQAYNLCMVGNAHFDSLYIRV

Ligands and cofactors

ID	Name	Formula	Copies
AYE	prop-2-en-1-amine	C3 H7 N	2
FLC	Citrate anion	C6 H5 O7	4

Primary citation

Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species. Deaton, M.K., Dzimianski, J.V., Daczkowski, C.M. et al. J Virol (2016) 90:8314-8327. DOI 10.1128/JVI.00975-16 · PubMed

Other PDB entries of the same protein (UniProt Q64339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHW 2.1 Å, Structure of ISG15 in space group P212121
5CHF 2.3 Å, Crystal structure of murine ISG15 in space group P21212
5TL7 2.44 Å, Crystal structure of SARS-CoV papain-like protease in complex with C-terminal domain…
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
5CHV 3.0 Å, Crystal structure of USP18-ISG15 complex
6YVA 3.18 Å, PLpro-C111S with mISG15
5TLA 3.24 Å, Crystal structure of mouse ISG15

Browse structure collections

About this viewer

MolViewer shows 5JZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.