5TLA: Mouse ISG15

Crystal structure of mouse ISG15. Determined by X-ray diffraction at 3.24 Å resolution. Released 3 May 2017.

Method: X-ray diffraction
Resolution: 3.24 Å
Organism: Mus musculus
Chains: 10
Atoms: 11,491
Mol. weight: 169.69 kDa
Released: 3 May 2017

Explore 5TLA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TLA contains 72 α-helices and 130 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	13-19	7	1
α-helix	25-35	11
α-helix	40-42	3
β-strand	43-47	5	1
β-strand	50-51	2	1
α-helix	52	1
α-helix	58-61	4
β-strand	68-73	6	1
α-helix	77-79	3
β-strand	80-85	6	2
β-strand	92-96	5	2
β-strand	101	1	3
α-helix	102-113	12
α-helix	117-119	3
β-strand	121-124	4	2
β-strand	127-128	2	2
α-helix	129-130	2
β-strand	134	1	3
α-helix	135-138	4
β-strand	145-149	5	2

Chain B: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	4
β-strand	13-20	8	4
β-strand	24	1	5
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	4
β-strand	50-51	2	4
α-helix	52	1
β-strand	57	1	5
β-strand	68-73	6	4
β-strand	80-85	6	6
β-strand	92-96	5	6
β-strand	101	1	7
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	6
β-strand	127-128	2	6
α-helix	129-130	2
β-strand	134	1	7
α-helix	135-138	4
β-strand	145-149	5	6

Chain C: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	8
β-strand	13-19	7	8
β-strand	24	1	9
α-helix	25-35	11
α-helix	40-42	3
β-strand	43-47	5	8
β-strand	50-51	2	8
β-strand	57	1	9
β-strand	68-73	6	8
β-strand	80-85	6	10
β-strand	91-96	6	10
β-strand	101	1	11
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	10
β-strand	127-128	2	10
α-helix	129-130	2
β-strand	134	1	11
α-helix	135-138	4
β-strand	145-149	5	10

Chain D: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	12
β-strand	13-18	6	12
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	12
β-strand	50-51	2	12
β-strand	68-73	6	12
α-helix	77-79	3
β-strand	80-85	6	13
β-strand	91-96	6	13
β-strand	101	1	14
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	13
β-strand	127-128	2	13
α-helix	129-130	2
β-strand	134	1	14
α-helix	135-138	4
β-strand	145-149	5	13

Chain E: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	15
α-helix	13-14	2
β-strand	15-17	3	15
α-helix	25-35	11
α-helix	40-42	3
β-strand	43-47	5	15
β-strand	50-51	2	15
β-strand	68-73	6	15
α-helix	77-79	3
β-strand	80-85	6	16
β-strand	93-96	4	16
β-strand	101	1	17
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	16
β-strand	127-128	2	16
α-helix	129-130	2
β-strand	134	1	17
α-helix	135-138	4
β-strand	145-149	5	16

Chain F: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	18
β-strand	15-19	5	18
β-strand	24	1	19
α-helix	25-35	11
α-helix	40-42	3
β-strand	43-47	5	18
β-strand	50-51	2	18
α-helix	52	1
β-strand	57	1	19
β-strand	68-73	6	18
α-helix	77-79	3
β-strand	80-85	6	20
β-strand	91-96	6	20
β-strand	101	1	21
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	20
β-strand	127-128	2	20
α-helix	129-130	2
β-strand	134	1	21
α-helix	135-138	4
β-strand	145-149	5	20

Chain G: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	22
β-strand	15-17	3	22
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	22
β-strand	50-51	2	22
α-helix	58-61	4
β-strand	69-73	5	22
α-helix	77-79	3
β-strand	80-85	6	23
β-strand	92-96	5	23
β-strand	101	1	24
α-helix	102-112	11
β-strand	121-124	4	23
β-strand	127-128	2	23
α-helix	129-130	2
β-strand	134	1	24
α-helix	135-138	4
β-strand	145-149	5	23

Chain H: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	25
β-strand	13-18	6	25
β-strand	24	1	26
α-helix	25-35	11
β-strand	46	1	27
β-strand	51	1	27
β-strand	57	1	26
β-strand	68-71	4	25
α-helix	77-79	3
β-strand	80-85	6	28
β-strand	93-96	4	28
β-strand	101	1	29
α-helix	102-112	11
α-helix	117-119	3
β-strand	121-124	4	28
β-strand	127-128	2	28
α-helix	129-130	2
β-strand	134	1	29
α-helix	135-138	4
β-strand	145-149	5	28

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein ISG15	A, B, C, D, E, F, G, H, I, J	protein	151	Mus musculus	Q64339 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>5TLA_1 Ubiquitin-like protein ISG15 (chains A, B, C, D, E, F, G, H, I, J)
HMAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLS
SLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQ
FWLSFEGRPMEDKELLGEYGLKPQCTVIKHL

Primary citation

Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Daczkowski, C.M., Dzimianski, J.V., Clasman, J.R. et al. J Mol Biol (2017) 429:1661-1683. DOI 10.1016/j.jmb.2017.04.011 · PubMed

Other PDB entries of the same protein (UniProt Q64339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHW 2.1 Å, Structure of ISG15 in space group P212121
5CHF 2.3 Å, Crystal structure of murine ISG15 in space group P21212
5TL7 2.44 Å, Crystal structure of SARS-CoV papain-like protease in complex with C-terminal domain…
5JZE 2.47 Å, Erve virus viral OTU domain protease in complex with mouse ISG15
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
5CHV 3.0 Å, Crystal structure of USP18-ISG15 complex
6YVA 3.18 Å, PLpro-C111S with mISG15

Browse structure collections

About this viewer

MolViewer shows 5TLA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.