Caspase-7 S239E Phosphomimetic. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jan 2017.
Explore 5K20 in 3D Show helices and sheets RCSB PDB PDBe
5K20 contains 21 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 59 | 1 | 1 |
| β-strand | 66 | 1 | 2 |
| β-strand | 68-74 | 7 | 3 |
| α-helix | 80-82 | 3 | |
| α-helix | 84-86 | 3 | |
| α-helix | 90-104 | 15 | |
| β-strand | 106-112 | 7 | 3 |
| α-helix | 116-128 | 13 | |
| β-strand | 134 | 1 | 2 |
| β-strand | 137-142 | 6 | 3 |
| β-strand | 145-146 | 2 | 4 |
| β-strand | 149-152 | 4 | 4 |
| β-strand | 155-158 | 4 | 4 |
| α-helix | 159-164 | 6 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-174 | 3 | |
| β-strand | 179-184 | 6 | 3 |
| β-strand | 190 | 1 | 5 |
| β-strand | 192 | 1 | 6 |
| β-strand | 195 | 1 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 213 | 1 | 8 |
| β-strand | 219-223 | 5 | 3 |
| β-strand | 229 | 1 | 5 |
| β-strand | 233 | 1 | 9 |
| β-strand | 239 | 1 | 9 |
| α-helix | 240-252 | 13 | |
| α-helix | 258-272 | 15 | |
| α-helix | 280-282 | 3 | |
| β-strand | 286 | 1 | 6 |
| β-strand | 290-293 | 4 | 3 |
| β-strand | 298 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 359 | 1 | 10 |
| β-strand | 366-374 | 9 | 3 |
| α-helix | 380-382 | 3 | |
| α-helix | 384-386 | 3 | |
| α-helix | 390-404 | 15 | |
| β-strand | 406-412 | 7 | 3 |
| α-helix | 416-428 | 13 | |
| β-strand | 434-442 | 9 | 3 |
| β-strand | 445-446 | 2 | 11 |
| β-strand | 449-452 | 4 | 11 |
| β-strand | 455-458 | 4 | 11 |
| α-helix | 459-463 | 5 | |
| α-helix | 464-466 | 3 | |
| α-helix | 468-470 | 3 | |
| α-helix | 472-474 | 3 | |
| β-strand | 479-484 | 6 | 3 |
| β-strand | 490 | 1 | 12 |
| β-strand | 492 | 1 | 13 |
| β-strand | 495 | 1 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 513 | 1 | 7 |
| β-strand | 519-523 | 5 | 3 |
| β-strand | 529 | 1 | 12 |
| β-strand | 533 | 1 | 14 |
| β-strand | 539 | 1 | 14 |
| α-helix | 540-552 | 13 | |
| α-helix | 558-572 | 15 | |
| α-helix | 580-582 | 3 | |
| β-strand | 586 | 1 | 13 |
| β-strand | 590-593 | 4 | 3 |
| β-strand | 598 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Caspase-7 large subunit | A, C | protein | 198 | Homo sapiens | P55210 (AlphaFold model) |
| Caspase-7 small subunit | B, D | protein | 113 | Homo sapiens | P55210 (AlphaFold model) |
>5K20_1 Caspase-7 large subunit (chains A, C) MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL FFIQACRGTELDDGIQAD
>5K20_2 Caspase-7 small subunit (chains B, D) SGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGEWFVQALCSILEEHGKDLEI MQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQLEHHHHHH
PAK2 Phosphorylation Inhibits Caspase-7 by Two Divergent Mechanisms: Slowing Activation and Blocking Substrate Binding. Eron, S.J., Hardy, J.A. To be published.
Other PDB entries of the same protein (UniProt P55210 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5K20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.