5L04: Tyrosine-protein kinase JAK1

Structure of interferon lambda 1 receptor with human kinase JAK1. Determined by X-ray diffraction at 2.1 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,221
Mol. weight: 69.43 kDa
Released: 12 Oct 2016

Explore 5L04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L04 contains 26 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	1
α-helix	46-47	2
β-strand	48-50	3	1
β-strand	53-56	4	2
α-helix	57-67	11
α-helix	75-77	3
β-strand	78-82	5	1
β-strand	87-88	2	1
α-helix	89-90	2
β-strand	94-97	4	2
β-strand	103-109	7	1
β-strand	127-128	2	3
β-strand	147	1	3
β-strand	150-151	2	4
α-helix	152-167	16
α-helix	172	1
β-strand	173	1	5
α-helix	174-176	3
α-helix	179-204	26
α-helix	217-220	4
α-helix	223-230	8
α-helix	234-250	17
α-helix	251-255	5
α-helix	256-259	4
α-helix	263-277	15
β-strand	278	1	5
β-strand	284-288	5	6
β-strand	291-293	3	7
β-strand	313-318	6	6
β-strand	322-327	6	6
α-helix	363	1
β-strand	364-367	4	6
α-helix	369-371	3
β-strand	372-378	7	7
β-strand	381-386	6	7
β-strand	391-395	5	7
α-helix	399-416	18
α-helix	425-427	3
α-helix	430-437	8
β-strand	440-441	2	8
α-helix	446-456	11
β-strand	463-467	5	8
β-strand	474-482	9	8
β-strand	493-503	11	8
β-strand	506-509	4	8
β-strand	516	1	8
α-helix	519-527	9
β-strand	529-533	5	9
β-strand	536-538	3	9
β-strand	543	1	8
β-strand	556-557	2	3
α-helix	559-562	4

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	262-264	3
α-helix	265-267	3
β-strand	278-279	2	4
α-helix	280-283	4
β-strand	291-294	4	9
α-helix	295-296	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK1	A	protein	550	Homo sapiens	P23458 (AlphaFold model)
Interferon lambda receptor 1	B	protein	48	Homo sapiens	Q8IU57 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5L04_1 Tyrosine-protein kinase JAK1 (chains A)
GAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWY
APNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPL
LDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLP
ELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVK
YLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKP
NVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDN
KKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYA
INKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQIEVQKGRYSL
HGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYP
MSQLSFDRSG

Sequence of entity 2 (B), FASTA

>5L04_2 Interferon lambda receptor 1 (chains B)
RAKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKELTRGVRPTPR

Primary citation

Crystal Structure of a Complex of the Intracellular Domain of Interferon lambda Receptor 1 (IFNLR1) and the FERM/SH2 Domains of Human JAK1. Zhang, D., Wlodawer, A., Lubkowski, J. J Mol Biol (2016) 428:4651-4668. DOI 10.1016/j.jmb.2016.10.005 · PubMed

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
10PI 1.54 Å, JAK1 kinase (JH1 domain) in complex with povorcitinib
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6GGH 1.7 Å, Human jak1 kinase domain in complex with inhibitor
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4L00 1.8 Å, Crystal structure of the apo Jak1 pseudokinase domain
6ELR 1.8 Å, Human jak1 kinase domain in complex with compound 7

Browse structure collections

About this viewer

MolViewer shows 5L04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.