Crystal structure of human PrimPol ternary complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 23 Nov 2016.
Explore 5L2X in 3D Show helices and sheets RCSB PDB PDBe
5L2X contains 24 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-16 | 15 | |
| α-helix | 36-38 | 3 | |
| β-strand | 43-45 | 3 | 1 |
| α-helix | 48-56 | 9 | |
| β-strand | 63-68 | 6 | 1 |
| α-helix | 69 | 1 | |
| β-strand | 76-81 | 6 | 1 |
| α-helix | 83-90 | 8 | |
| β-strand | 99-102 | 4 | 1 |
| β-strand | 109 | 1 | 2 |
| β-strand | 112-118 | 7 | 3 |
| α-helix | 127-146 | 20 | |
| α-helix | 152-154 | 3 | |
| β-strand | 155-159 | 5 | 3 |
| β-strand | 165-172 | 8 | 3 |
| β-strand | 177-179 | 3 | 2 |
| α-helix | 182-192 | 11 | |
| α-helix | 194-198 | 5 | |
| α-helix | 264-266 | 3 | |
| β-strand | 267-269 | 3 | 4 |
| β-strand | 275-277 | 3 | 4 |
| β-strand | 279 | 1 | 3 |
| α-helix | 281-283 | 3 | |
| β-strand | 289-291 | 3 | 1 |
| β-strand | 293 | 1 | 5 |
| β-strand | 296 | 1 | 6 |
| β-strand | 303 | 1 | 6 |
| β-strand | 304 | 1 | 5 |
| β-strand | 305-306 | 2 | 3 |
| α-helix | 314-316 | 3 | |
| α-helix | 322-330 | 9 | |
| β-strand | 342-344 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-45 | 4 | 7 |
| α-helix | 48-58 | 11 | |
| β-strand | 63-68 | 6 | 7 |
| β-strand | 76-81 | 6 | 7 |
| α-helix | 83-90 | 8 | |
| β-strand | 99-103 | 5 | 7 |
| β-strand | 109 | 1 | 2 |
| β-strand | 112-118 | 7 | 8 |
| α-helix | 127-146 | 20 | |
| α-helix | 152-154 | 3 | |
| β-strand | 155-159 | 5 | 8 |
| β-strand | 165-172 | 8 | 8 |
| β-strand | 177-179 | 3 | 2 |
| α-helix | 182-197 | 16 | |
| α-helix | 264-266 | 3 | |
| β-strand | 267-269 | 3 | 9 |
| β-strand | 275-277 | 3 | 9 |
| β-strand | 279 | 1 | 8 |
| α-helix | 281-283 | 3 | |
| β-strand | 288-291 | 4 | 7 |
| α-helix | 292 | 1 | |
| β-strand | 293 | 1 | 10 |
| β-strand | 296 | 1 | 11 |
| β-strand | 303 | 1 | 11 |
| β-strand | 304 | 1 | 10 |
| β-strand | 305-306 | 2 | 8 |
| α-helix | 314-316 | 3 | |
| α-helix | 322-330 | 9 | |
| α-helix | 335-337 | 3 | |
| β-strand | 342-344 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA-directed primase/polymerase protein | A, B | protein | 353 | Homo sapiens | Q96LW4 (AlphaFold model) |
| DNA (5'-D(P*TP*CP*GP*CP*(5IU)P*AP*CP*C)-3') | C, G | DNA | 17 | Homo sapiens | |
| DNA (5'-d(p*gp*gp*tp*ap*gp*cp*(ddg))-3') | D, H | DNA | 13 | Homo sapiens |
>5L2X_1 DNA-directed primase/polymerase protein (chains A, B) MNRKWEAKLKQIEERASHYERKPLSSVYRPRLSKPEEPPSIWRLFHRQAQAFNFVKSCKE DVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKP ANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAFK DNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHFSEAPARQGFSFNKMFTEKATE ESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFVDLGVYTRNRNFRLYKSSKIGK RVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQ
>5L2X_2 DNA (5'-D(P*TP*CP*GP*CP*(5IU)P*AP*CP*C)-3') (chains C, G) CATCGCUACCACACCCC
>5L2X_3 DNA (5'-D(P*GP*GP*TP*AP*GP*CP*(DDG))-3') (chains D, H) GGGTGTGGTAGCG
Structure and mechanism of human PrimPol, a DNA polymerase with primase activity. Rechkoblit, O., Gupta, Y.K., Malik, R. et al. Sci Adv (2016) 2:e1601317-e1601317. DOI 10.1126/sciadv.1601317 · PubMed
Other PDB entries of the same protein (UniProt Q96LW4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5L2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.