5N8A: RPA70N

Structure of RPA70N in complex with PrimPol (fragment 480-560). Determined by X-ray diffraction at 1.28 Å resolution. Released 7 Jun 2017.

Method: X-ray diffraction
Resolution: 1.28 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,200
Mol. weight: 24.52 kDa
Released: 7 Jun 2017

Explore 5N8A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5N8A contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	9-11	3
α-helix	12-16	5
β-strand	24-33	10	1
α-helix	34	1
β-strand	41-47	7	1
β-strand	51-58	8	1
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	1
β-strand	92-103	12	1
α-helix	105-108	4
β-strand	116-117	2	1

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed primase/polymerase protein	X	protein	102	Homo sapiens	Q96LW4 (AlphaFold model)
Replication protein A 70 kDa DNA-binding subunit	A	protein	121	Homo sapiens	P27694 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>5N8A_1 DNA-directed primase/polymerase protein (chains X)
MGSSHHHHHHSSGLVPRGSHMTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGID
DAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE

Sequence of entity 2 (A), FASTA

>5N8A_2 Replication protein A 70 kDa DNA-binding subunit (chains A)
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLA
TQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYN
E

Primary citation

Molecular basis for PrimPol recruitment to replication forks by RPA. Guilliam, T.A., Brissett, N.C., Ehlinger, A. et al. Nat Commun (2017) 8:15222-15222. DOI 10.1038/ncomms15222 · PubMed

Other PDB entries of the same protein (UniProt Q96LW4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5N85 2.0 Å, Structure of RPA70N in complex with PrimPol (fragment 514-525)
7JLG 2.07 Å, Human PrimPol extending from the erroneous primer base A opposite the 8-oxoguanine lesion
7JL8 2.1 Å, Human PrimPol extending from the correct primer base C opposite the 8-oxoguanine lesion
5L2X 2.2 Å, Crystal structure of human PrimPol ternary complex
7JKL 2.38 Å, Human PrimPol misinserting dATP opposite the 8-oxoguanine lesion (3'-end base of the…
7JKP 2.59 Å, Human PrimPol misinserting dATP opposite the 8-oxoguanine lesion
7JK1 2.62 Å, Human PrimPol inserting correct dCTP opposite the 8-oxoguanine lesion

Browse structure collections

About this viewer

MolViewer shows 5N8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.