Structure of RPA70N in complex with PrimPol (fragment 514-525). Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Jun 2017.
Explore 5N85 in 3D Show helices and sheets RCSB PDB PDBe
5N85 contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-4 | 4 | |
| α-helix | 9-11 | 3 | |
| α-helix | 12-16 | 5 | |
| β-strand | 24-33 | 10 | 1 |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 51-58 | 8 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-67 | 5 | |
| β-strand | 76-86 | 11 | 1 |
| β-strand | 92-103 | 12 | 1 |
| α-helix | 105-108 | 4 | |
| β-strand | 116-117 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 6-8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Replication protein A 70 kDa DNA-binding subunit | A | protein | 123 | Homo sapiens | P27694 (AlphaFold model) |
| DNA-directed primase/polymerase protein | B | protein | 15 | Homo sapiens | Q96LW4 (AlphaFold model) |
>5N85_1 Replication protein A 70 kDa DNA-binding subunit (chains A) GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFM LATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVP YNE
>5N85_2 DNA-directed primase/polymerase protein (chains B) DNGIDDAYFLEATED
Molecular basis for PrimPol recruitment to replication forks by RPA. Guilliam, T.A., Brissett, N.C., Ehlinger, A. et al. Nat Commun (2017) 8:15222-15222. DOI 10.1038/ncomms15222 · PubMed
Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5N85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.