Myelin-associated glycoprotein (MAG) glycosylated and lysine-methylated full extracellular domain. Determined by X-ray diffraction at 4.3 Å resolution. Released 14 Dec 2016.
Explore 5LFU in 3D Show helices and sheets RCSB PDB PDBe
5LFU contains 6 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-25 | 3 | 1 |
| β-strand | 29-32 | 4 | 2 |
| β-strand | 38-40 | 3 | 3 |
| β-strand | 43-45 | 3 | 1 |
| β-strand | 55-61 | 7 | 2 |
| β-strand | 72-75 | 4 | 2 |
| β-strand | 78 | 1 | 2 |
| β-strand | 89-91 | 3 | 3 |
| α-helix | 95-97 | 3 | |
| β-strand | 99 | 1 | 1 |
| β-strand | 102-104 | 3 | 3 |
| α-helix | 109-111 | 3 | |
| β-strand | 113-121 | 9 | 2 |
| β-strand | 126-128 | 3 | 2 |
| β-strand | 133-137 | 5 | 2 |
| β-strand | 142-144 | 3 | 4 |
| β-strand | 149-150 | 2 | 5 |
| β-strand | 155-161 | 7 | 4 |
| β-strand | 171-175 | 5 | 6 |
| α-helix | 182 | 1 | |
| β-strand | 183 | 1 | 4 |
| α-helix | 184 | 1 | |
| β-strand | 188-191 | 4 | 4 |
| β-strand | 195-204 | 10 | 4 |
| β-strand | 214-220 | 7 | 6 |
| β-strand | 227-233 | 7 | 6 |
| β-strand | 236-237 | 2 | 5 |
| β-strand | 241-245 | 5 | 7 |
| β-strand | 249-252 | 4 | 8 |
| β-strand | 257-264 | 8 | 7 |
| β-strand | 270-274 | 5 | 8 |
| β-strand | 282-284 | 3 | 8 |
| β-strand | 287-292 | 6 | 7 |
| β-strand | 301-309 | 9 | 8 |
| β-strand | 312-323 | 12 | 8 |
| α-helix | 325-329 | 5 | |
| β-strand | 330-333 | 4 | 9 |
| β-strand | 343-348 | 6 | 9 |
| β-strand | 356-361 | 6 | 10 |
| β-strand | 364-369 | 6 | 10 |
| β-strand | 375-379 | 5 | 9 |
| α-helix | 384-386 | 3 | |
| β-strand | 388-395 | 8 | 10 |
| β-strand | 401-407 | 7 | 10 |
| β-strand | 414-415 | 2 | 11 |
| β-strand | 420-423 | 4 | 11 |
| β-strand | 428-435 | 8 | 11 |
| β-strand | 441-445 | 5 | 12 |
| β-strand | 462-466 | 5 | 11 |
| β-strand | 469-476 | 8 | 11 |
| β-strand | 486-491 | 6 | 12 |
| β-strand | 496-501 | 6 | 12 |
| β-strand | 503 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myelin-associated glycoprotein | A | protein | 500 | Mus musculus | P20917 (AlphaFold model) |
>5LFU_1 Myelin-associated glycoprotein (chains A) GSGHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSR TQVVHESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSEHSVLDI VNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPTVLGRLREDEGTWV QVSLLHFVPTREANGHRLGCQAAFPNTTLQFEGYASLDVKYPPVIVEMNSSVEAIEGSHV SLLCGADSNPPPLLTWMRDGMVLREAVAKSLYLDLEEVTPGEDGVYACLAENAYGQDNRT VELSVMYAPWKPTVNGTVVAVEGETVSILCSTQSNPDPILTIFKEKQILATVIYESQLQL ELPAVTPEDDGEYWCVAENQYGQRATAFNLSVEFAPIILLESHCAAARDTVQCLCVVKSN PEPSVAFELPSRNVTVNETEREFVYSERSGLLLTSILTIRGQAQAPPRVICTSRNLYGTQ SLELPFQGAHRAAAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
| MAN | alpha-D-mannopyranose | C6 H12 O6 | 1 |
Structural basis of myelin-associated glycoprotein adhesion and signalling. Pronker, M.F., Lemstra, S., Snijder, J. et al. Nat Commun (2016) 7:13584-13584. DOI 10.1038/ncomms13584 · PubMed
Other PDB entries of the same protein (UniProt P20917 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LFU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.