6GZL: Dynein light chain 1, cytoplasmic

Complex between the dynein light chain DYNLL1/DLC8 and a peptide from the large myelin-associated glycoprotein L-MAG. Determined by X-ray diffraction at 1.95 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 877
Mol. weight: 12.55 kDa
Released: 10 Oct 2018

Explore 6GZL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GZL contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
β-strand	6-13	8	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	1
β-strand	63-69	7	2
β-strand	72-78	7	1
β-strand	81-87	7	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	607-613	7	2
α-helix	614-616	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 1, cytoplasmic	A	protein	90	Homo sapiens	P63167 (AlphaFold model)
Pro-thr-lys-asp-ser-tyr-thr-leu-thr-glu-glu-leu	B	protein	17	Mus musculus	P20917 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GZL_1 Dynein light chain 1, cytoplasmic (chains A)
SMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVG
RNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (B), FASTA

>6GZL_2 PRO-THR-LYS-ASP-SER-TYR-THR-LEU-THR-GLU-GLU-LEU (chains B)
KRPTKDSYTLTEELAEY

Primary citation

High-affinity heterotetramer formation between the large myelin-associated glycoprotein and the dynein light chain DYNLL1. Myllykoski, M., Eichel, M.A., Jung, R.B. et al. J Neurochem (2018) 147:764-783. DOI 10.1111/jnc.14598 · PubMed

Other PDB entries of the same protein (UniProt P63167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9NZ7 1.41 Å, Crystal structure of human DYNLL1-S64A/S88A mutant dimer
6GZJ 1.98 Å, Complex between the dynein light chain DYNLL1/DLC8 and the specific domain of large…
3ZKE 2.2 Å, Structure of LC8 in complex with Nek9 peptide
7D35 2.4 Å, Human LC8 bound to ebola virus VP35(67-76)
1CMI 2.5 Å, Structure of the human PIN/LC8 dimer with a bound peptide
3ZKF 2.6 Å, Structure of LC8 in complex with Nek9 phosphopeptide
9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
8RGG 4.0 Å, Structure of dynein-2 intermediate chain DYNC2I2 (WDR34) in complex with dynein-2 heavy…
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition

Browse structure collections

About this viewer

MolViewer shows 6GZL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.