Complex between the dynein light chain DYNLL1/DLC8 and a peptide from the large myelin-associated glycoprotein L-MAG. Determined by X-ray diffraction at 1.95 Å resolution. Released 10 Oct 2018.
Explore 6GZL in 3D Show helices and sheets RCSB PDB PDBe
6GZL contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-5 | 2 | |
| β-strand | 6-13 | 8 | 1 |
| α-helix | 15-31 | 17 | |
| α-helix | 35-50 | 16 | |
| β-strand | 54-59 | 6 | 1 |
| β-strand | 63-69 | 7 | 2 |
| β-strand | 72-78 | 7 | 1 |
| β-strand | 81-87 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 607-613 | 7 | 2 |
| α-helix | 614-616 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dynein light chain 1, cytoplasmic | A | protein | 90 | Homo sapiens | P63167 (AlphaFold model) |
| Pro-thr-lys-asp-ser-tyr-thr-leu-thr-glu-glu-leu | B | protein | 17 | Mus musculus | P20917 (AlphaFold model) |
>6GZL_1 Dynein light chain 1, cytoplasmic (chains A) SMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVG RNFGSYVTHETKHFIYFYLGQVAILLFKSG
>6GZL_2 PRO-THR-LYS-ASP-SER-TYR-THR-LEU-THR-GLU-GLU-LEU (chains B) KRPTKDSYTLTEELAEY
High-affinity heterotetramer formation between the large myelin-associated glycoprotein and the dynein light chain DYNLL1. Myllykoski, M., Eichel, M.A., Jung, R.B. et al. J Neurochem (2018) 147:764-783. DOI 10.1111/jnc.14598 · PubMed
Other PDB entries of the same protein (UniProt P63167 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GZL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.