Crystal structure of glycosylated Myelin-associated glycoprotein (MAG) Ig1-3 with soaked trisaccharide ligand. Determined by X-ray diffraction at 2.3 Å resolution. Released 14 Dec 2016.
Explore 5LFV in 3D Show helices and sheets RCSB PDB PDBe
5LFV contains 17 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-25 | 3 | 1 |
| β-strand | 29-33 | 5 | 2 |
| β-strand | 38-40 | 3 | 3 |
| β-strand | 43-45 | 3 | 1 |
| α-helix | 48-50 | 3 | |
| β-strand | 56-61 | 6 | 2 |
| α-helix | 70-71 | 2 | |
| β-strand | 72-75 | 4 | 2 |
| β-strand | 89-91 | 3 | 3 |
| α-helix | 95-97 | 3 | |
| β-strand | 99 | 1 | 1 |
| β-strand | 102-104 | 3 | 3 |
| α-helix | 109-111 | 3 | |
| β-strand | 113-120 | 8 | 2 |
| β-strand | 126-138 | 13 | 2 |
| α-helix | 141 | 1 | |
| β-strand | 142-144 | 3 | 4 |
| β-strand | 149-150 | 2 | 5 |
| β-strand | 155-162 | 8 | 4 |
| α-helix | 169-170 | 2 | |
| β-strand | 171-175 | 5 | 6 |
| α-helix | 178-180 | 3 | |
| β-strand | 184-190 | 7 | 4 |
| α-helix | 192-194 | 3 | |
| β-strand | 196-204 | 9 | 4 |
| α-helix | 208-210 | 3 | |
| β-strand | 214-220 | 7 | 6 |
| β-strand | 227-233 | 7 | 6 |
| β-strand | 236-237 | 2 | 5 |
| β-strand | 238-245 | 8 | 7 |
| β-strand | 249-252 | 4 | 8 |
| β-strand | 257-266 | 10 | 7 |
| α-helix | 268-269 | 2 | |
| β-strand | 270-275 | 6 | 8 |
| β-strand | 278-284 | 7 | 8 |
| β-strand | 287-292 | 6 | 7 |
| α-helix | 297-299 | 3 | |
| β-strand | 301-309 | 9 | 8 |
| β-strand | 312-324 | 13 | 8 |
| α-helix | 325-328 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-25 | 3 | 9 |
| β-strand | 29-33 | 5 | 10 |
| β-strand | 38-40 | 3 | 11 |
| β-strand | 43-45 | 3 | 9 |
| β-strand | 56-61 | 6 | 10 |
| α-helix | 66-68 | 3 | |
| β-strand | 72-75 | 4 | 10 |
| α-helix | 83-85 | 3 | |
| β-strand | 89-92 | 4 | 11 |
| β-strand | 99 | 1 | 9 |
| β-strand | 101-104 | 4 | 11 |
| α-helix | 109-111 | 3 | |
| β-strand | 113-120 | 8 | 10 |
| β-strand | 126-128 | 3 | 10 |
| β-strand | 133-138 | 6 | 10 |
| β-strand | 142-144 | 3 | 12 |
| β-strand | 149-150 | 2 | 13 |
| β-strand | 155-162 | 8 | 12 |
| β-strand | 171-175 | 5 | 14 |
| β-strand | 184-189 | 6 | 12 |
| β-strand | 197-204 | 8 | 12 |
| α-helix | 208-210 | 3 | |
| β-strand | 214-220 | 7 | 14 |
| β-strand | 227-233 | 7 | 14 |
| β-strand | 236-237 | 2 | 13 |
| β-strand | 238-245 | 8 | 15 |
| β-strand | 249-252 | 4 | 16 |
| β-strand | 257-266 | 10 | 15 |
| β-strand | 270-275 | 6 | 17 |
| β-strand | 278-284 | 7 | 17 |
| β-strand | 287-292 | 6 | 15 |
| β-strand | 302-309 | 8 | 17 |
| β-strand | 312-319 | 8 | 17 |
| β-strand | 320-324 | 5 | 16 |
| α-helix | 325-328 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myelin-associated glycoprotein | A, B | protein | 317 | Mus musculus | P20917 (AlphaFold model) |
>5LFV_1 Myelin-associated glycoprotein (chains A, B) GSGHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSR TQVVHESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSEHSVLDI VNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPTVLGRLREDEGTWV QVSLLHFVPTREANGHRLGCQAAFPNTTLQFEGYASLDVKYPPVIVEMNSSVEAIEGSHV SLLCGADSNPPPLLTWMRDGMVLREAVAKSLYLDLEEVTPGEDGVYACLAENAYGQDNRT VELSVMYAAAAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 5 |
| MAN | alpha-D-mannopyranose | C6 H12 O6 | 2 |
Water and common crystallization additives (SO4, GOL) are not listed.
Structural basis of myelin-associated glycoprotein adhesion and signalling. Pronker, M.F., Lemstra, S., Snijder, J. et al. Nat Commun (2016) 7:13584-13584. DOI 10.1038/ncomms13584 · PubMed
Other PDB entries of the same protein (UniProt P20917 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.