5LKT: PDB entry 5LKT

Name: PDB 5LKT: Crystal structure of the p300 acetyltransferase catalytic core with butyryl-coenzyme A.
Published: 2016-11-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of the p300 acetyltransferase catalytic core with butyryl-coenzyme A. Determined by X-ray diffraction at 2.04 Å resolution. Released 2 Nov 2016.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,960
Mol. weight: 68.59 kDa
Ligands: BCO, ZN
Released: 2 Nov 2016

Explore 5LKT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LKT contains 36 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	1051-1066	16
α-helix	1073-1075	3
α-helix	1089-1092	4
α-helix	1099-1107	9
α-helix	1114-1131	18
α-helix	1137-1159	23
β-strand	1169	1	1
α-helix	1170-1174	5
β-strand	1175-1176	2	2
β-strand	1184-1185	2	2
β-strand	1190-1194	5	3
β-strand	1198-1201	4	3
α-helix	1202-1207	6
β-strand	1212-1215	4	4
β-strand	1224-1227	4	4
α-helix	1228-1230	3
β-strand	1232-1235	4	3
α-helix	1240	1
β-strand	1241	1	1
α-helix	1242-1243	2
β-strand	1244-1246	3	5
β-strand	1253-1255	3	5
α-helix	1256-1259	4
α-helix	1273-1278	6
α-helix	1283-1285	3
α-helix	1294-1295	2
α-helix	1297-1313	17
β-strand	1321-1334	14	6
α-helix	1335-1336	2
α-helix	1337-1339	3
α-helix	1340-1344	5
β-strand	1352-1366	15	6
β-strand	1369-1381	13	6
α-helix	1386	1
β-strand	1392-1400	9	6
α-helix	1407-1409	3
α-helix	1410-1428	19
β-strand	1432-1436	5	6
α-helix	1439-1441	3
α-helix	1456-1459	4
α-helix	1460-1476	17
β-strand	1482-1485	4	6
α-helix	1486-1492	7
α-helix	1498-1500	3
α-helix	1508-1519	12
α-helix	1584-1590	7
α-helix	1592-1594	3
β-strand	1595-1599	5	6
α-helix	1603-1607	5
α-helix	1609-1612	4
α-helix	1617-1618	2
β-strand	1619	1	6
α-helix	1622-1624	3
α-helix	1628-1636	9
α-helix	1644-1661	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase p300,Histone acetyltransferase p300	A	protein	578	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LKT_1 Histone acetyltransferase p300,Histone acetyltransferase p300 (chains A)
GAMAGKAVPMQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDI
VKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQE
IDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGES
VSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVC
DGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKT
VEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRR
VYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHP
PDQKIPKPKRLQEWFKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNV
LEESIKESGGSGSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRD
AFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRF

Ligands and cofactors

ID	Name	Formula	Copies
BCO	Butyryl Coenzyme A	C25 H42 N7 O17 P3 S	1
ZN	Zinc ion	Zn	4

Water and common crystallization additives (CL, DMS, GOL) are not listed.

Primary citation

Structure of p300 in complex with acyl-CoA variants. Kaczmarska, Z., Ortega, E., Goudarzi, A. et al. Nat Chem Biol (2017) 13:21-29. DOI 10.1038/nchembio.2217 · PubMed

Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BT3 1.05 Å, Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
3T92 1.5 Å, Crystal structure of the Taz2:C/EBPepsilon-TAD chimera protein
5LPM 1.5 Å, Crystal structure of the bromodomain of human Ep300 bound to the inhibitor XDM3d
5NU5 1.6 Å, Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
3BIY 1.7 Å, Crystal structure of p300 histone acetyltransferase domain in complex with a bisubstrate…
6PGU 1.72 Å, Crystal structure of the p300 acetyltransferase domain with allosteric inhibitor CPI-076…
6V8K 1.84 Å, Crystal structure of the p300 acetyltransferase domain with peptide-competitive…
4PZS 1.94 Å, Crystal structure of p300 histone acetyltransferase domain in complex with…
5KJ2 1.95 Å, The novel p300/CBP inhibitor A-485 uncovers a unique mechanism of action to target AR in…
6DS6 1.95 Å, Crystal structure of p300 ZZ domain in complex with histone H3 peptide
7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7UGI 2.0 Å, Bromodomain of EP300 liganded with BMS-536924

Browse structure collections

About this viewer

MolViewer shows 5LKT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.