5LP2: HopQ

Adhesin domain of the type 1 HopQ of Helicobacter pylori strain G27. Determined by X-ray diffraction at 2.6 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Helicobacter pylori (strain G27)
Chains: 4
Atoms: 10,987
Mol. weight: 186.52 kDa
Released: 12 Oct 2016

Explore 5LP2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LP2 contains 64 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	32-39	8
α-helix	53-72	20
α-helix	78-97	20
α-helix	98-100	3
β-strand	101	1	7
β-strand	103	1	8
β-strand	106	1	9
β-strand	116-121	6	10
β-strand	127-132	6	10
β-strand	151	1	9
β-strand	153	1	11
β-strand	157	1	11
β-strand	158	1	8
α-helix	160-175	16
α-helix	176-180	5
α-helix	182-184	3
β-strand	191-201	11	10
β-strand	207-217	11	10
α-helix	220-237	18
α-helix	239	1
β-strand	240	1	12
β-strand	241	1	7
α-helix	242-243	2
α-helix	259-262	4
β-strand	268	1	12
α-helix	274-298	25
α-helix	301-305	5
α-helix	316-350	35
α-helix	388-404	17
α-helix	406-422	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HopQ	A, B, C, D	protein	434	Helicobacter pylori (strain G27)	B5Z8H1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5LP2_1 HopQ (chains A, B, C, D)
MAVQKVKNADKVQKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTT
NSPAYQATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGS
TNSNGTHSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAH
VTTSKYQQDNQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTNNA
NTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNLNS
PSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMTMQ
NQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRNMGMIA
SSTTNNGAHHHHHH

Primary citation

Helicobacter pylori adhesin HopQ engages in a virulence-enhancing interaction with human CEACAMs. Javaheri, A., Kruse, T., Moonens, K. et al. Nat Microbiol (2016) 2:16189-16189. DOI 10.1038/nmicrobiol.2016.189 · PubMed

Other PDB entries of the same protein (UniProt B5Z8H1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QFA 2.49 Å, CryoEM structure of a beta3K279T GABA(A)R homomer in complex with histamine and megabody…
9FFU 2.5 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
6XVI 2.6 Å, Crystal structure of Megabody Mb-Nb207-c7HopQ_A12
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
6GBG 2.8 Å, Helicobacter pylori adhesin HopQ type I bound to the N-terminal domain of human CEACAM1
9FFL 2.8 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
6QD6 2.84 Å, Molecular scaffolds expand the nanobody toolkit for cryo-EM applications: crystal…
7QHA 2.97 Å, Cryo-EM structure of the Tripartite ATP-independent Periplasmic (TRAP) transporter SiaQM…
9FFM 3.0 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with Mb25 in the…
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
9FFN 3.1 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
9FFQ 3.1 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…

Browse structure collections

About this viewer

MolViewer shows 5LP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.